KEGG   Phoenix dactylifera (date palm): 103713811Help
Entry
103713811         CDS       T03274                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00010  Glycolysis / Gluconeogenesis
pda00020  Citrate cycle (TCA cycle)
pda00620  Pyruvate metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01200  Carbon metabolism
Module
pda_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103713811
   00020 Citrate cycle (TCA cycle)
    103713811
   00620 Pyruvate metabolism
    103713811
Enzymes [BR:pda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103713811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103713811
NCBI-ProteinID: XP_008799059
UniProt: A0A2H3YHX0
LinkDB All DBs
Position
Unknown
AA seq 477 aa AA seqDB search
MAGVGQLHLGTPFLPSASIRGRSSGGGGSRRLTTRIQAKIREIFMPALSSTMTEGKIVSW
VRAEGDKLSKGESVVVVESDKADMDVETFYDGYLAAIMVEEGDVAAVGSAIALLAETEDE
IPLAKSQASSSSSPAASPPAAETPVPPSPSETAPEAVSSPPPSPKSSQAAVSSTHPASES
GRRIVATPYAKKLAKDLKVELGSVAGSGPMGRIVAKDVEAAAAVAAAAAPVSSVPPKSIS
DSAAVKAPASPAIQLGTVVPFTTMQGAVSKNMVESLSVPTFRVGYTITTDALDSLYKKIK
SKGVTMTALLAKATALALTKHPVVNSSCRDGKSFTYNSSINIAVAVAIDGGLITPVLQDA
DKVDIYSLSRKWKELVDKARAKQLQPHEYNNGTFTLSNLGMFGVDRFDAILPPGTGAIMA
VGASQPTVVATKDGRIGVKSQMQVNVTADHRVIYGADLAAFLQTLAKIIEDPKELTL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtcggccagctccatctcggcacccccttcctcccttccgcctccatccgc
gggcggtcctctggcggcgggggatcccgaaggctgaccacgcggattcaggccaagatc
cgcgagatcttcatgccggcgctgagctcgacgatgaccgagggaaagatcgtttcttgg
gtgagggccgagggcgacaagctctccaaaggtgagagcgtcgtcgtcgtcgagtctgat
aaggccgacatggacgtcgagacattctacgatggatatctcgcggcgatcatggtcgag
gagggcgacgtcgccgcagtcggctccgctatcgccctccttgccgagactgaggacgag
atcccccttgccaaatcccaggcctcctcctcctcctcccccgccgcttctcctccggcc
gccgaaaccccagtcccaccatctccttcagagaccgccccagaagccgtatcctctcct
ccgccttctccgaaatcctcccaggccgctgtttcttctacccatccggcatctgagagc
gggcgcaggatcgtggccacgccctatgcgaagaagctcgccaaggatctgaaggtggag
ctgggatccgtggccgggagtgggccgatgggaagaattgtggccaaggatgtggaagct
gcggctgcggtggcggctgctgctgcccctgtgtcgagcgttccaccgaaatccatctcc
gattctgctgcggtgaaggctccagcttctccagccatccaattgggcactgtggttcca
ttcaccacaatgcagggtgccgtcagcaagaacatggtggagagcctctcggtgcctacg
ttccgggttggttataccatcaccacggatgcacttgatagcctctacaagaaaataaag
tcgaaaggagtgaccatgactgcactgctagcaaaggcgactgctttggcattgacaaag
caccctgttgttaattccagctgtagggatggtaagagcttcacatacaacagcagcatc
aacattgctgttgccgtggctatcgatggagggttgattactccggttctgcaggatgct
gacaaggttgacatctattcattgtcaaggaaatggaaggagttggttgataaggctcga
gctaagcagctgcaacctcatgagtacaacaatggtacattcactctttcgaaccttgga
atgtttggtgttgaccgttttgatgcaattttgcctcctggaactggcgcaatcatggct
gttggtgcctcccagccaactgttgttgccacaaaggatggtaggattggtgtgaagagt
cagatgcaggtgaatgtaactgcagatcaccgggtaatttatggagcggatcttgctgcc
ttcttgcaaactctggccaaaattattgaggatcccaaagagctgacattgtag

DBGET integrated database retrieval system