KEGG   Pocillopora damicornis (lace coral): 113675332
Entry
113675332         CDS       T05773                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113675332
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113675332
NCBI-ProteinID: XP_027047694
LinkDB
Position
Unknown
AA seq 106 aa
MNPEESKAKKCLFGRPDHKELDEYLKKELKKDVQEKNEKWNFDFEKGVPKEGGTFQWEKV
GSVETERDDSKVGESSAAEKEEVKEVAKNSADKYSQLPQTPPKNGR
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaatcccgaagagagcaaagcaaagaagtgcctctttgggcgaccagatcacaaagaa
ctggatgaatatttgaagaaggaattaaagaaagatgtacaagagaagaacgaaaaatgg
aatttcgatttcgagaaaggggtaccgaaggagggaggaacatttcaatgggaaaaagtt
gggtcggttgaaaccgagagagacgattctaaagttggagagagcagcgctgcggaaaaa
gaggaagttaaggaagttgcgaagaattcagccgataaatactcacagcttcctcaaact
ccgccgaaaaatggcagatga

DBGET integrated database retrieval system