KEGG   Pocillopora damicornis (lace coral): 113686166Help
Entry
113686166         CDS       T05773                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00010  Glycolysis / Gluconeogenesis
pdam00030  Pentose phosphate pathway
pdam00051  Fructose and mannose metabolism
pdam00052  Galactose metabolism
pdam01100  Metabolic pathways
pdam01200  Carbon metabolism
pdam01230  Biosynthesis of amino acids
pdam03018  RNA degradation
Module
pdam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113686166
   00030 Pentose phosphate pathway
    113686166
   00051 Fructose and mannose metabolism
    113686166
   00052 Galactose metabolism
    113686166
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    113686166
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pdam01009]
    113686166
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdam03019]
    113686166
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     113686166
Protein phosphatases and associated proteins [BR:pdam01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113686166
Messenger RNA biogenesis [BR:pdam03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     113686166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 113686166
NCBI-ProteinID: XP_027059563
LinkDB All DBs
Position
Unknown
AA seq 833 aa AA seqDB search
MSQVILYLLIELTKRLKQLMSPSGTGKQPLKRKAEDVSFDFDTDEPAAKREAFARTRLPT
LLNVEGAGQCIAVLTSGGDAQGMNAAIRAVVRMGIYAGARVFTVWEGYQGLVDGGDNIRE
VRWEEVSGIIQLGGTVIGSARCKDFRSREGRLTAAKNMVTLGITNLVVIGGDGSLTGANL
FRQEWQELLEELVETGAVTEKMAQENNHLNIVGMVGSIDNDFCGTDMTIGADSALHRIFE
AVDAITTTASSHQRTFVLEVMGRHCGYLALVTGLGVGADYIFIPEWPVQEGWEEKMCNHL
RKVRDSGRRLCIIIVAEGAQDVAGNPVTANDIKELVKTKLQHDARVTILGHVQRGGIPSA
FDRILSCRMGAEAALAVLDAKPDTAPCVICLDGNKIKKRVLMECVRKTLEVKDATKAKNF
DKVVELRGRTFQSNIEIFKVLREVEPPASSQCDISGTCKSGHTLAVINIGAPAGGMSTAV
RAFVRFSLCQGHTVLGIRDGINGLFDDKVEQLGWLHVDSWAGAGGSKLGTTRTLPSKDMQ
KVAEKLSKHGIQGLLVIGGFEAYNAVLELAEARDKFPAFRIPMVIIPATISNNVPGTDLS
LGVDTALNVITENCDRIKQSASSATRRVFVVECMGGYCGYLATMSALAGGADAAYIFEEK
LTLEDLKKNIEHLIDKMKGSVRRGLILRNEKCSENYTTDFISALYREEGEGLFTVRTNVL
GHVQQGGSPSPFDRIQATRQATLAVNWLTQRIGENLTDQGSVETSSPSTACLLGIKKSDN
PFTPVQDLKSVTDFKHRVPKEQWWLEMRSLQKILAKYQQHFDYHREDDLSPLP
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtaattttgtacttgctcatcgaactaaccaagaggctaaagcaactcatg
tccccttctggtaccgggaaacaacctcttaagcgaaaagccgaagatgtttcgttcgat
tttgacacagatgaaccggccgccaagagggaagcttttgcacgaactcggttgccaact
ttgctgaatgtcgaaggagccggtcaatgtattgctgttttaacaagcggtggagatgca
caagggatgaatgcagccatcagagctgtggttaggatgggtatctatgcaggagccagg
gtctttactgtgtgggagggttatcagggattggtggatggtggtgataacatcagagaa
gtcagatgggaggaagtgtctggtatcattcaactgggaggaacagtcattggaagtgca
agatgtaaagattttagatcgcgtgaaggtcgtttaacagctgctaagaacatggtgacc
ttaggcataacaaatttagttgttattggaggtgatggtagtttaacaggggccaatctg
ttcagacaggaatggcaagagcttttggaagagctggtagaaactggtgctgtgactgaa
aaaatggcacaagaaaataatcaccttaatatagtggggatggttggctcaattgacaat
gatttctgtggcactgatatgaccattggagctgattcagcacttcataggatttttgaa
gcagtagatgccattacaacaacagcttcaagccatcagaggacttttgtccttgaagtt
atggggagacattgtggatacctagctcttgttacaggcttgggagttggtgcagactat
attttcatccctgaatggcctgtccaagaaggttgggaggaaaaaatgtgcaatcacttg
agaaaagtcagggatagtggaagacgtttatgcattatcattgtggcagagggtgctcag
gatgttgcaggaaaccctgtcactgctaatgacattaaggagcttgtcaagacaaaactc
cagcacgatgcacgagtcacgattcttggacatgtccagagaggaggaatcccatctgct
tttgacagaattctgtcttgtcgcatgggagcagaggcagccctcgctgtcttggatgcc
aagccagatactgccccatgtgtaatctgcctggacggaaacaagatcaagaaaagagta
ctcatggaatgtgtccgtaagactctggaggtcaaggacgcaacgaaagcaaagaacttt
gataaagttgtcgaactgaggggaagaaccttccagagcaacatagagattttcaaagtc
ttgagggaagtggagcctccagcctcgagccagtgtgatatatctggcacttgcaaatct
ggtcacaccttggcagttatcaacattggtgcccctgcaggaggcatgagcactgctgtc
cgtgcctttgtccgcttctcactctgtcaaggacacacagtgctgggaatcagagatgga
atcaatgggctctttgatgacaaggtggaacaactaggatggctccatgtcgactcttgg
gcaggggcaggaggatccaaattgggaaccacaagaaccttaccttctaaagatatgcaa
aaggttgcagaaaagttatctaaacacgggattcaaggactgttggttattggaggcttt
gaggcttacaacgctgttctggagcttgcagaagcccgtgacaagttcccagctttccgc
attccaatggttatcattcccgccacaattagtaacaatgtgcccggtacagatcttagt
ttaggagtagacacagctctcaatgtgataacagagaattgtgaccgcatcaagcagtct
gccagcagtgcaacgagacgcgtgtttgttgttgagtgcatgggcggctactgtggttac
ctagcaaccatgagcgccctcgcgggaggagctgacgcagcgtacatctttgaagagaaa
cttactcttgaagatttgaagaaaaacatcgagcatttgatagacaaaatgaaaggttct
gtgcgaagaggactcattttgcggaacgagaaatgcagcgaaaattacacgacagacttc
atctcggctctatatcgagaagaaggagagggccttttcacggtcagaaccaatgtactt
ggtcacgtgcagcagggtggatctccgtcgccttttgatcgaatccaggccaccagacag
gcgactttggccgttaactggctgactcaaaggattggggagaatttaacagatcaagga
tctgttgaaacttcatctccaagcactgcttgtctattgggtatcaagaagtctgataac
cctttcacgccagttcaagatctgaaaagtgtcacagactttaaacaccgcgtccccaaa
gagcaatggtggttagaaatgcgttccttacagaaaatattggccaaatatcagcagcat
tttgactaccaccgggaagacgatttatcccctcttccatga

DBGET integrated database retrieval system