KEGG   Paenibacillus durus: PDUR_18940Help
Entry
PDUR_18940        CDS       T03297                                 

Definition
(GenBank) [NiFe] hydrogenase small subunit HydA
  KO
K06282  hydrogenase small subunit [EC:1.12.99.6]
Organism
pdu  Paenibacillus durus
Pathway
pdu00633  Nitrotoluene degradation
pdu01120  Microbial metabolism in diverse environments
pdu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PDUR_18940
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PDUR_18940
Enzymes [BR:pdu01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With unknown physiological acceptors
    1.12.99.6  hydrogenase (acceptor)
     PDUR_18940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q6 NiFe_hyd_SSU_C TAT_signal
Motif
Other DBs
NCBI-ProteinID: AIQ13761
UniProt: A0A089HP23
LinkDB All DBs
Position
complement(4201206..4202093)
Genome map
AA seq 295 aa AA seqDB search
MRINRRDFLKWSVAAVAALKLEMDMDKLNTVMAADTDPPVIWLLGSGCSGCSISTLNVTN
PTTIEDVLQNKISMKYDSTLMAASGESAMQALENAANQYNGQFILVIEGAIPGGASKNYC
IIGEQNGVPLTMYDAVLKYGPKAKYVVSAGTCASFGGVAAAAPNSTGCVTVKSLLSGQTA
NPVVNLAGCPVNATVMVQTLLDLILTGVPSLDNNGRPSKYFGTSIHSVCPRRGQTQVSQP
GIYGCYKSVGCKGPFNQSPCPSLKWNNQQGWCIQSDYPCIGCTAPAFPLNPLINA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcaacagaagggattttctcaagtggtcggtggcggcagtggcagcgctgaaa
ttggaaatggatatggacaagctgaacacggtgatggcagcggacacggacccgccggtg
atttggctgctgggatcgggttgttcgggctgcagcatatccactctgaacgtgacgaac
ccgaccaccatcgaagatgtgcttcagaacaaaatcagtatgaagtatgatagcacgctc
atggcggcctcaggtgaaagtgcaatgcaggcgcttgaaaatgcggcgaaccagtataac
ggacaattcattcttgtaatcgagggtgctattccggggggagcctccaagaactactgt
attatcggtgagcagaacggggttccgcttaccatgtatgatgctgtactcaaatatgga
ccgaaagcgaaatacgtcgtatcggcaggcacctgcgcctccttcggcggtgtggcagcc
gcagcccccaacagcacaggatgcgtaaccgttaaatcactgctgagcggccaaaccgcg
aacccggtcgtcaatttggcgggatgtcctgtgaatgcgacggtaatggtgcagacactg
cttgatttaattttgactggtgtaccttctctcgacaataacggccgcccgagtaaatat
ttcggcacaagcatacatagtgtgtgtccgagaagaggacaaacccaggtctcccagcct
ggaatttatggctgctataagagtgtcggctgtaaaggtccctttaaccaatcgccatgc
ccgtcgctcaagtggaacaaccaacaaggctggtgcatccaatcggactacccgtgcatc
ggttgcacagcacctgcattcccgctaaatccactcatcaacgcttaa

DBGET integrated database retrieval system