KEGG   Pseudonocardia dioxanivorans: Psed_1040Help
Entry
Psed_1040         CDS       T01479                                 

Definition
(GenBank) Acetylornithine transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00250  Alanine, aspartate and glutamate metabolism
pdx00410  beta-Alanine metabolism
pdx00640  Propanoate metabolism
pdx00650  Butanoate metabolism
pdx01100  Metabolic pathways
pdx01120  Microbial metabolism in diverse environments
Module
pdx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Psed_1040
   00650 Butanoate metabolism
    Psed_1040
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psed_1040
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psed_1040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pdx01007]
    Psed_1040
Enzymes [BR:pdx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Psed_1040
Amino acid related enzymes [BR:pdx01007]
 Aminotransferase (transaminase)
  Class III
   Psed_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEA23291
UniProt: F4CMF1
LinkDB All DBs
Position
1097508..1098764
Genome map
AA seq 418 aa AA seqDB search
MASLSPLLVQATPVQVARGEGVHLYDTDGNRYLDFTAGIGVTSTGHCHPRVVAAAQEQVA
TLIHGQYTTVMHQPLLRLTERLGDVLPAGIDSVFYVNSGSEAVEASVRLARHATGRPLVV
AFDGGFHGRTMGAAALTTSGAKIRSGNTPMMGGVAFAPFPYAYRYGWSEDEAVAFALREL
DRLLLTAAPAADVAAFIVEPVLGEGGYVPTPASFLVGLRERADRHGILLIADEVQTGFGR
TGLFWGHQHAPGVTPDVIVTAKGLASGFPLSAIAAPAALMAKGRPGSQGGTYGGNAVACA
AALATLDVIEDEGLVANAAKQGLRLLDAARDLAADHPGIGDVRGRGLMVGTEFVTPDGRP
DGATAARAHAAAAAHGLLLLTCGAEGHVVRMIPPLVVTADQVDEGIALWSKALTDATT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctgtctccgctcctcgtgcaggccaccccggttcaggtggcccgtggcgag
ggcgtccacctctacgacaccgacggcaaccggtacctcgacttcaccgcggggatcggc
gtcaccagcaccgggcactgccacccgcgggtcgtcgcggcggcgcaggagcaggtcgcg
acgctgatccacgggcagtacacgaccgtcatgcaccagccgctgctgcgcctgaccgag
cggctcggcgacgtcctgcccgccgggatcgacagcgtcttctacgtcaactccggcagc
gaggccgtcgaggcgtcggtccggctggcgcggcacgccacggggcgcccgctggtcgtc
gcgttcgacggcggcttccacggacgcacgatgggcgcggccgcgctcacgacgtcgggc
gccaagatccgctccggcaacaccccgatgatgggcggcgtcgcgttcgcgccgttcccc
tacgcctaccgctacggctggagcgaggacgaggccgtcgccttcgccctgcgcgagctc
gaccgcctgctcctcaccgccgcgccggccgccgacgtggccgcgttcatcgtcgagccc
gtactgggcgagggcggctacgtgccgacgcccgcgtcgttcctcgtggggctgcgcgag
cgcgcggaccggcacggcatcctgctgatcgccgacgaggtgcagacgggcttcgggcgc
accggcctgttctggggccaccagcacgcgccgggcgtgacgccggacgtcatcgtcacc
gccaaggggctggccagcggcttcccgctgtcggcgatcgcggcgcccgccgcgctgatg
gccaagggccgtcccgggtcgcagggcgggacctacggcggcaacgccgtcgcctgcgcg
gccgcgctcgcgacgctcgacgtcatcgaggacgagggactcgtcgccaacgcggcgaag
cagggcctgcggctgctcgacgcggcgcgcgacctcgcggccgaccaccccggcatcggc
gacgtccggggccgcgggctgatggtcggcacggagttcgtcacgcccgacggccggccc
gacggcgcgaccgccgcccgtgcccacgccgccgcggccgcgcacggcctgctgctgctc
acctgcggggccgaggggcacgtcgtgcggatgatcccgccgctcgtggtcaccgcggac
caggtcgacgagggcatcgccctctggtcgaaggccctgacggacgcgaccacctga

DBGET integrated database retrieval system