KEGG   Candidatus Sodalis pierantonius: SOPEG_1354Help
Entry
SOPEG_1354        CDS       T03006                                 

Gene name
arcA
Definition
(GenBank) Aerobic respiration control protein arcA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
pes  Candidatus Sodalis pierantonius
Pathway
pes02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pes00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SOPEG_1354 (arcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pes02022]
    SOPEG_1354 (arcA)
Two-component system [BR:pes02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   SOPEG_1354 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AHF73606
UniProt: W0HIJ0
LinkDB All DBs
Position
complement(1403246..1403962)
Genome map
AA seq 238 aa AA seqDB search
MQTPHILIVEDESVTRNTLKSIFEAEGYMVHEATDGAEMHRALSEHDINLVIMDINLPGK
NGLLLARELREHASVALMFLTGRDNEVDRILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNLGGALEERKLVESYKFNGWELDINSRSLLSPHGESYKLPRSEFRAMLHFCENPGKIQ
SRAELLKKMTGRELKAHDRTVDVTIRRIRKHFESLPDTPEIIATIHGEGYRFCGDLEE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgcacattcttatcgttgaagacgagtcagtcacccgtaataccctcaaa
agcatttttgaagccgagggctatatggtccatgaagctaccgacggcgcagagatgcat
cgcgccctgtcggaacatgatattaatttggttatcatggatatcaacctgccgggtaaa
aatggtttattgctggcgcgagaactccgtgagcatgccagcgtcgctttgatgtttctc
accggccgcgataacgaagttgacaggatcctcgggctggaaatcggcgccgacgactat
attaccaagcccttcaacccccgcgaactcactatacgcgcgcgcaatttgctgtcccgc
accatgaatttgggcggcgcgcttgaggagcgcaaattggtggagagctataaattcaac
ggctgggagcttgatatcaatagccgttcgctgcttagcccccacggtgagagttataag
ctgccgcgcagcgaattccgcgccatgctgcatttttgcgagaatccaggcaagatccaa
tcccgcgccgaactgttgaaaaaaatgaccggccgcgagctcaaggcccacgaccgtacc
gtggacgtcactatccgccgcatccgaaaacattttgaatcgttgccggatacgccggaa
atcatcgccaccattcatggcgaaggttatcgtttctgcggcgatttggaagagtaa

DBGET integrated database retrieval system