KEGG   Pandoraea faecigallinarum: AB870_03685Help
Entry
AB870_03685       CDS       T03972                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pfg  Pandoraea faecigallinarum
Pathway
pfg00020  Citrate cycle (TCA cycle)
pfg00480  Glutathione metabolism
pfg01100  Metabolic pathways
pfg01110  Biosynthesis of secondary metabolites
pfg01120  Microbial metabolism in diverse environments
pfg01130  Biosynthesis of antibiotics
pfg01200  Carbon metabolism
pfg01210  2-Oxocarboxylic acid metabolism
pfg01230  Biosynthesis of amino acids
Module
pfg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB870_03685
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AB870_03685
Enzymes [BR:pfg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AB870_03685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AKM29430
UniProt: A0A0H3WPH9
LinkDB All DBs
Position
3475907..3478147
Genome map
AA seq 746 aa AA seqDB search
MSTQQPSIIYTLTDEAPLLATSSFLPIIRTFTAPAGVAIETSDISVAGRILGEFPEFLTE
EQRVPDNLAELGRLTQDPNTNIIKLPNISASVFQLQSAIKELQSKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTIDKARDVKMELVTNSGKTIVLKPKVSLLDGEIIDSMFMSKKALCDFYEE
QMEDARKTGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGLV
NLYEKIEALPSTQREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDIATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVEKYLKDHDTNGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNERAKILARTLDAATGKLLDNNKGPSPKTGELDNR
GSQFYLSMYWAQELAGQKDDAELAKLFAPLAKQLTENEKTIVGELADVQGKPTDIGGYYK
PDFEKLEQVMRPSKTFNAALASVATA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcagcaacccagcatcatctacaccctgaccgacgaagcaccgcttctggcc
accagttccttcctcccgatcatccgcacgttcaccgctccggcgggcgtggcgatcgag
acgagcgacatctcggtcgcgggccgtatcctcggcgaattccccgaattcctgaccgaa
gagcagcgcgtgccggacaacctggccgaactcggtcgcctgacgcaggacccgaacacg
aacatcatcaagctgccgaacatcagcgcttcggtgttccagctccagagcgcgatcaag
gaactccagtcgaagggctacaaggtccccgattacccggaagatccgaagaccgacgaa
gagaaggccatccagaagcgctactcgaagtgcctcggttcggccgtgaaccctgtcctg
cgcgaaggcaactcggatcgccgcgcgccgctcgccgtcaagaactacgccaggaagcac
ccgcacagcatgggtgagtggagcatggcgtcgcgcacgcacgtcgcgcacatgaagcat
ggcgacttctaccacggcgaaaagtcgatgacgatcgacaaggcccgcgacgtgaagatg
gaactcgtcaccaacagcggcaagacgattgttctgaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctgtgcgacttctacgaggaa
cagatggaagacgcccgcaagaccggcgtcatgttctcgctgcacgtgaaagcgaccatg
atgaaggtctcgcacccgatcgtgttcggccacgccgtgaagatcttctacaaggaagcc
ttcgaaaagcacggcaagctgttcgacgaactgggtgtgaacgtcaacaacggtctcgtg
aacctgtacgagaagatcgaagcgctgccgagcacgcagcgtgaagagatcatccgcgat
ctgcacgcctgccatgaacaccgcccggaactggcgatggtcgactcggccaaggggatc
tcgaacctgcacgcgccgaacgacgtgatcgtcgacgcatcgatgcccgccatgatccga
atcggcggcaagatgtggggcgccgatggccgtccgaaggacacgaaggccgtgattccg
gaaagcacgttcgcccgcatctatcaggaaatcatcaacttctgcaaaacgaacggcgca
ttcgacccgaccacgatgggtacggtaccgaacgtcggcctgatggcgcagaaagcagaa
gagtatggctcgcacgacaagacgttcgagatcgccgaagacggcgtggcgaacatcgtc
gacattgccacgggtgaagtgctgctctcgcaaaacgtggaagccggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtgaagctcgccgtgaaccgtgtg
cgcaactcgggcatgccggccgtgttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtggaaaagtacctgaaggatcacgacaccaacggtctcgacatccag
atcatgtcgcaggtgcgcgccatgcgctacacgctcgagcgcgtgatccgcggcctggac
acgatttcggtgactggcaacattctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctctccatcgtgccgctgatggccggtggcggtatg
tacgaaacgggcgccggcggttcggcaccgaagcacgtcaagcagttggtggaagaaaac
cacctgcgctgggactcgctgggtgaattcctggcactggccgtttcgctggaagatctg
ggtatcaagacgggtaacgaacgcgccaagatcctggccaggacgctcgacgccgcaacg
ggcaagctgctcgacaacaacaagggtccctcgccgaagaccggcgagttggacaaccgc
ggcagccagttctatctgtcgatgtactgggcgcaggaactggccgggcagaaggacgac
gccgaactggccaagctgttcgcaccgctcgccaagcaactgaccgagaacgagaagacg
atcgtgggcgaactcgccgacgtgcaaggcaagccgaccgacatcggcggttactacaag
ccggacttcgaaaagctcgaacaggtcatgcgcccgagcaagacgttcaacgcggcactg
gcgagcgtcgcaacggcgtaa

DBGET integrated database retrieval system