KEGG   Pandoraea faecigallinarum: AB870_03685Help
Entry
AB870_03685       CDS       T03972                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pfg  Pandoraea faecigallinarum
Pathway
pfg00480  Glutathione metabolism
pfg01100  Metabolic pathways
pfg01110  Biosynthesis of secondary metabolites
pfg01120  Microbial metabolism in diverse environments
pfg01130  Biosynthesis of antibiotics
pfg01200  Carbon metabolism
pfg01210  2-Oxocarboxylic acid metabolism
pfg01230  Biosynthesis of amino acids
Module
pfg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB870_03685
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AB870_03685
Enzymes [BR:pfg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AB870_03685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AKM29430
UniProt: A0A0H3WPH9
LinkDB All DBs
Position
3475907..3478147
Genome map
AA seq 746 aa AA seqDB search
MSTQQPSIIYTLTDEAPLLATSSFLPIIRTFTAPAGVAIETSDISVAGRILGEFPEFLTE
EQRVPDNLAELGRLTQDPNTNIIKLPNISASVFQLQSAIKELQSKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTIDKARDVKMELVTNSGKTIVLKPKVSLLDGEIIDSMFMSKKALCDFYEE
QMEDARKTGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGLV
NLYEKIEALPSTQREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDIATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVEKYLKDHDTNGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNERAKILARTLDAATGKLLDNNKGPSPKTGELDNR
GSQFYLSMYWAQELAGQKDDAELAKLFAPLAKQLTENEKTIVGELADVQGKPTDIGGYYK
PDFEKLEQVMRPSKTFNAALASVATA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcagcaacccagcatcatctacaccctgaccgacgaagcaccgcttctggcc
accagttccttcctcccgatcatccgcacgttcaccgctccggcgggcgtggcgatcgag
acgagcgacatctcggtcgcgggccgtatcctcggcgaattccccgaattcctgaccgaa
gagcagcgcgtgccggacaacctggccgaactcggtcgcctgacgcaggacccgaacacg
aacatcatcaagctgccgaacatcagcgcttcggtgttccagctccagagcgcgatcaag
gaactccagtcgaagggctacaaggtccccgattacccggaagatccgaagaccgacgaa
gagaaggccatccagaagcgctactcgaagtgcctcggttcggccgtgaaccctgtcctg
cgcgaaggcaactcggatcgccgcgcgccgctcgccgtcaagaactacgccaggaagcac
ccgcacagcatgggtgagtggagcatggcgtcgcgcacgcacgtcgcgcacatgaagcat
ggcgacttctaccacggcgaaaagtcgatgacgatcgacaaggcccgcgacgtgaagatg
gaactcgtcaccaacagcggcaagacgattgttctgaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctgtgcgacttctacgaggaa
cagatggaagacgcccgcaagaccggcgtcatgttctcgctgcacgtgaaagcgaccatg
atgaaggtctcgcacccgatcgtgttcggccacgccgtgaagatcttctacaaggaagcc
ttcgaaaagcacggcaagctgttcgacgaactgggtgtgaacgtcaacaacggtctcgtg
aacctgtacgagaagatcgaagcgctgccgagcacgcagcgtgaagagatcatccgcgat
ctgcacgcctgccatgaacaccgcccggaactggcgatggtcgactcggccaaggggatc
tcgaacctgcacgcgccgaacgacgtgatcgtcgacgcatcgatgcccgccatgatccga
atcggcggcaagatgtggggcgccgatggccgtccgaaggacacgaaggccgtgattccg
gaaagcacgttcgcccgcatctatcaggaaatcatcaacttctgcaaaacgaacggcgca
ttcgacccgaccacgatgggtacggtaccgaacgtcggcctgatggcgcagaaagcagaa
gagtatggctcgcacgacaagacgttcgagatcgccgaagacggcgtggcgaacatcgtc
gacattgccacgggtgaagtgctgctctcgcaaaacgtggaagccggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtgaagctcgccgtgaaccgtgtg
cgcaactcgggcatgccggccgtgttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtggaaaagtacctgaaggatcacgacaccaacggtctcgacatccag
atcatgtcgcaggtgcgcgccatgcgctacacgctcgagcgcgtgatccgcggcctggac
acgatttcggtgactggcaacattctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctctccatcgtgccgctgatggccggtggcggtatg
tacgaaacgggcgccggcggttcggcaccgaagcacgtcaagcagttggtggaagaaaac
cacctgcgctgggactcgctgggtgaattcctggcactggccgtttcgctggaagatctg
ggtatcaagacgggtaacgaacgcgccaagatcctggccaggacgctcgacgccgcaacg
ggcaagctgctcgacaacaacaagggtccctcgccgaagaccggcgagttggacaaccgc
ggcagccagttctatctgtcgatgtactgggcgcaggaactggccgggcagaaggacgac
gccgaactggccaagctgttcgcaccgctcgccaagcaactgaccgagaacgagaagacg
atcgtgggcgaactcgccgacgtgcaaggcaagccgaccgacatcggcggttactacaag
ccggacttcgaaaagctcgaacaggtcatgcgcccgagcaagacgttcaacgcggcactg
gcgagcgtcgcaacggcgtaa

DBGET integrated database retrieval system