KEGG   Pseudomonas frederiksbergensis: PFAS1_11765
Entry
PFAS1_11765       CDS       T04786                                 

Definition
(GenBank) type VI secretion-associated protein
  KO
K11890  type VI secretion system protein ImpM
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PFAS1_11765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfk02044]
    PFAS1_11765
Secretion system [BR:pfk02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PFAS1_11765
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: APV39989
UniProt: A0A1P8EUV7
LinkDB
Position
2563445..2564098
AA seq 217 aa
MNTPGFYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQTSLGDRWLDAYLVSPLWRF
MVGPGVCGPQAAVGVVMPSIDRVGRYFPLTVAVLLDHDADPASVVGGSDIWFEQVEQLLL
STLSVEASFEAFGAELEALGSPACLPRTPSSRFAGLHRFDATDSKARMSALAEQACEGSS
LWWGQGSERIAPALLRCQGLPVAADFAQFLLGQEGVA
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaacacgccgggcttctatggaaagttggccagccgcggggactttgtcagccgaggc
ttgccgcagagttttatcggcccctgggattcgtggctggcggcgggcctgctcgccagc
cagaccagcctcggcgaccgttggctggatgcctatctggtcagcccgctgtggcgcttt
atggtcgggcccggagtatgcgggccgcaggccgccgttggggtggtgatgccgagcatc
gatcgggttggccggtattttccgctgaccgtcgcagtgctgctggaccacgatgctgat
ccggcatcggtggtgggcggttcggatatctggtttgaacaggttgagcaattgctgttg
agcacgttgagcgtggaggcgagcttcgaagccttcggcgcggagttggaagcactgggt
agcccggcgtgcctgccgcgcacgccaagcagccgttttgccggcctgcatcgcttcgat
gccaccgattcgaaggcgcgcatgagcgcacttgccgaacaggcctgcgaaggctcaagc
ctgtggtggggccagggttcggagcgtatcgcccccgctttattacggtgtcagggcctg
cctgtcgccgccgattttgcgcaatttttgctcggccaagaaggtgttgcgtag

DBGET integrated database retrieval system