KEGG   Anthracocystis flocculosa: PFL1_02257Help
Entry
PFL1_02257        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K16833  protein phosphatase inhibitor 2
Organism
pfp  Anthracocystis flocculosa
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pfp01009]
    PFL1_02257
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pfp03036]
    PFL1_02257
Protein phosphatases and associated proteins [BR:pfp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PFL1_02257
Chromosome and associated proteins [BR:pfp03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     PFL1_02257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPP-2 SWIRM-assoc_2 PPP4R2
Motif
Other DBs
NCBI-GeneID: 19316378
NCBI-ProteinID: XP_007877961
LinkDB All DBs
Position
Unknown
AA seq 321 aa AA seqDB search
MPAGELRSYAMSSPRHSPPRSAAAPRPKGILKNASERTTSQGAAPPLVSPTSVNPDDANN
HLQWDETNLTLHELQRAQEEARMKIDEPKTPFVRSASLGPFGDDDMSFDLDAAGPSTPGS
RRGSAANQLAANTSANAGRRPSASDPASGSGVAGTGTGLAVGLDAADLARSASGTSQSHA
GSENEAGLQRAPSSRSTSRSPSFSLPKTSSRRSSARSATGDIDQRTGLRQENEERNMQVD
DDDEDDGAVEEEDPDPETQAKHAAFAAKRNQHYGNEAEAMKIAAALAARDDDEDEDDDDE
EDAAQSGPPPVPPLPNGSRQG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgggcgagctacgatcgtacgccatgtcttcgccgcgccactcgccgccccgc
tccgccgcggcacccagacccaaggggatcctcaagaatgctagcgaaaggaccacctcc
cagggcgccgctccgcccctcgtttcccccacctctgtcaaccccgacgacgcaaacaac
cacctgcaatgggacgagaccaacctcaccctccacgagcttcagcgcgcacaggaagag
gctcgcatgaagatcgacgagccaaagacgccctttgtccgcagcgccagcctcggtcct
tttggagacgacgacatgagctttgacctggacgctgccggaccatcgacccctggcagc
cgtcgaggatcggccgctaatcagctggccgccaacacgtcggccaatgccggtcgtcga
ccttccgcttcggaccctgcatcgggcagcggcgtcgcaggcacgggcaccggactggcc
gtcggcttggatgccgccgacctcgctcgctccgcgagtggcacaagccagagccacgcc
ggcagcgagaacgaagccggcctccagcgcgctccgagctcgaggagcaccagccgttcg
cccagcttctcgctgccaaagacttcgagcaggagatcgagcgcgcgcagcgccaccggc
gacatcgaccagaggaccggcctgaggcaggagaacgaggagcgaaacatgcaggtcgac
gacgacgacgaagacgatggcgccgtcgaggaggaggatcccgatcccgagacccaagcc
aagcacgccgcgtttgcagcaaagagaaaccagcactacggcaacgaggccgaggcgatg
aagattgcagccgcgctcgcggcccgcgatgacgacgaggatgaggacgatgacgacgaa
gaggacgctgcccagagcggcccgcctccggttccgccgctccccaatggctcgcgacag
ggctga

DBGET integrated database retrieval system