KEGG   Pyrococcus furiosus DSM 3638: PF1975Help
Entry
PF1975            CDS       T00075                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00620  Pyruvate metabolism
pfu00680  Methane metabolism
pfu00720  Carbon fixation pathways in prokaryotes
pfu01100  Metabolic pathways
pfu01120  Microbial metabolism in diverse environments
pfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PF1975
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PF1975
   00680 Methane metabolism
    PF1975
Enzymes [BR:pfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PF1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: AAL82099
UniProt: Q8TZL5
LinkDB All DBs
Position
1825412..1826830
Genome map
AA seq 472 aa AA seqDB search
MIPRIMSTQHPDNYSIPFFASSPILEGEDEITEAFYAFSVLGADEQMWDFEGKEVDEFVV
KKLLERYPTFFKNNILGKDIRLTPRVPNPSVEKEEAKLLLETLQGIARSADYARIFYGDN
IAPIFEVILPMTTSVEEIERVYWLYKKAVVWISREKIYDITVREWIGDFFPEKINVIPLF
ETKSALIKAAKITEAYILNRKNDIEYQRVFFARSDPAMNYGLITAVTYVKRALYEVLKVE
EELSIPIYPIIGVGGPPLRGGMRPDNVDAVVKEYPSVQTFTIQSSFKYDYPTKDVVKAVE
KIKSTKRKLPIPVEIPPFLVNYEAEYQKQIRILAPYINSVAKRIPRRRKRKLHIGLFGYS
RNVNGITLPRAITFTAALYSIGIPPELLALNSLTDSQLETISEYYINVYEDLEFAMRFFS
PKVAEKVGLKELAERVKEFKPEQIPEYIEEAEIVFKGEGDVMKLAQLRGFLG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaataatgagtactcaacatcctgacaactattcaataccatttttcgct
agctcccccatactagagggagaagatgagataacggaggcattctatgccttcagtgtc
cttggagcagatgaacaaatgtgggactttgaaggaaaagaagttgatgaattcgttgtt
aaaaaacttctcgagagatacccaacatttttcaagaacaatattcttggaaaggatatt
cgcctgaccccaagagttccaaacccaagtgtagaaaaagaagaagcaaagttacttctc
gaaacccttcaaggaatcgcaagaagtgcggattatgcaaggatattctatggagataac
atagctccaatattcgaagtaatacttcccatgacaactagtgtagaggaaattgagaga
gtatactggctctataagaaggcagtagtttggataagcagagagaaaatctatgatata
acagtaagggagtggatcggagatttcttcccagaaaaaattaatgtaatcccactgttt
gagacgaaatccgctctaatcaaagctgcaaaaataacagaagcttacatactaaatagg
aagaatgacattgagtatcagagggtcttttttgctagaagtgatcccgcaatgaactac
ggtctaattacagcagtcacttacgttaaaagggcactatatgaagttctaaaggtagaa
gaggagctcagcattccaatatacccaattatcggagttggtggtcctcccttgagagga
ggaatgagaccagataacgttgatgcagtagtaaaggaatatccaagtgtccaaaccttc
acaatccagagctccttcaagtatgactacccaaccaaagacgtcgttaaggcggtagag
aaaattaaatcgacaaaaagaaagttgccaattccagttgaaattcctccatttctggtt
aactatgaggcagaataccaaaagcagattagaattctagccccatacataaacagcgta
gcaaagagaatacccaggagaagaaagaggaagctccacataggattattcggatattca
agaaatgtgaacgggataactctgcccagagcaatcacattcactgctgccctttactcc
atcggaatccccccagaacttcttgcattaaactcactcacagactcccaactcgaaaca
atttcagaatactacatcaacgtatatgaagacttagaatttgccatgagatttttctct
ccaaaagttgctgaaaaggtaggattgaaagagctagcagaaagggtcaaggaattcaaa
ccagagcaaatccctgagtacattgaggaggcagaaatagtgtttaaaggggaaggagat
gtgatgaagctggcccagttaagagggtttcttggataa

DBGET integrated database retrieval system