KEGG   Prevotella fusca: ADJ77_00130Help
Entry
ADJ77_00130       CDS       T04032                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfus  Prevotella fusca
Brite
KEGG Orthology (KO) [BR:pfus00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ADJ77_00130
Enzymes [BR:pfus01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ADJ77_00130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_binding_2 Thi4 DAO FAD_oxidored NAD_binding_8 AlaDh_PNT_C FAD_binding_3 K_oxygenase Lycopene_cycl Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AKU68332
UniProt: A0A0K1NGV4
LinkDB All DBs
Position
1:complement(28627..30180)
Genome map
AA seq 517 aa AA seqDB search
MLDSNILEQVKGVFASLSSDITLSVIRNSNDENTAEFSSFIEDFASTSDKIKTVYQEGEQ
FSFSILRNGEETGISFRGIPNGHEFTSLLLAVLNTDGQGKNLPDEAIAARIKSLKGEIHL
QTYVSLTCTNCPDVVQALNVMALINPNISNEMVDGGLCQDEIQRLNIQGVPSVYVNGEPL
HTGRGDLGILLQELEDKVGTNHDENAVQTVHEYDVIVLGGGPAGASSAIYSARKGLRVAI
VAERIGGQVNDTTGIENLISVTKTTGIQLAADLRTHINDYSIDVFDSRKVVSTNLKEAVK
TVSVRGGETFTAPAVVIATGASWRRLGLPDEDKYIGHGEHFCPHCDGPFYKGKDVAVIGG
GNSGIEAAIDLAGICRHVTVLEFADAMRADEVLQQKVTSLPNVEVFLSTQTTALLGDGQK
LSGIRVKDRTNDEEREIALDGVFVQIGLSPNSDAFKDEVEVTPRNEIIVDATNRTSLSGV
YAAGDVTTVPYKQITIAMGEGAKAALSAFDDRIRGVI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttagattcaaacatactcgaacaggtgaaaggcgtgttcgcatcgctttcatcagac
ataacgctcagcgtaatacgtaacagtaatgacgagaatacagcagagttctcttccttc
atagaagactttgcctctacttctgataaaatcaagactgtctatcaggaaggagaacag
ttctcattcagcatccttcgcaatggtgaagagactggtatcagcttccgtggtatacca
aacggacacgagtttacctcgttgctccttgctgtcctcaatactgacggacagggtaag
aaccttcctgacgaggcgatagctgcacgtatcaagtcactgaagggtgaaatccacctt
cagacctacgtttctctcacctgtacgaactgtcctgacgttgttcaggcactgaacgtg
atggcgctcatcaacccaaatatcagcaatgagatggttgacggtggtctatgtcaggac
gagatacaacgtttgaacatacagggcgtaccttctgtgtacgtcaatggggagcctttg
catacgggtcgtggcgaccttggcatccttctgcaggaattagaggacaaagtaggcacc
aaccacgatgagaatgctgtgcagacagtgcatgaatatgatgttatcgtactcggtggt
ggtcctgccggagcatcttctgccatctactctgcccgcaaaggcttgcgcgtagctatc
gttgctgaacgcatcggaggacaggtaaacgacacgacaggtatcgagaaccttatctct
gtcacaaagacaaccggtatacagcttgctgctgacctccgcacacatatcaatgactat
tctatcgacgtgttcgacagccgcaaggtcgtttctaccaacctgaaagaggctgtgaag
acggtttctgtccgtggcggcgaaaccttcaccgcaccagccgttgtgatcgcaacaggt
gcaagctggcgccgtcttggtctgccagatgaggacaaatacatcggtcatggtgagcat
ttctgcccacattgcgacggccctttctacaaaggcaaggacgtagcagtcatcggtggt
ggtaattctggtatcgaagcagccatcgacttggctggcatctgtcgccacgtgacggtt
cttgagttcgctgatgctatgcgtgccgatgaggttctgcagcagaaagtgaccagtctg
cctaatgttgaggtgttcctttctacccagacaacagccctcttgggtgatggtcagaag
ttatcgggtatcagagtgaaggaccgcaccaatgacgaagagcgcgaaattgccttagat
ggcgtctttgttcagattggcttgtcgccaaacagcgatgctttcaaggacgaagtggag
gttactccacgtaatgagattatcgttgacgcaaccaatcgtaccagtctgagtggcgta
tatgctgccggtgacgttacaacggtaccttacaaacagattacaattgccatgggagaa
ggtgctaaggctgccctttcagcctttgacgaccggatccgtggcgtgatataa

DBGET integrated database retrieval system