KEGG   Photobacterium gaetbulicola: H744_1c0357
Entry
H744_1c0357       CDS       T03698                                 

Definition
(GenBank) putative glycosidase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00052  Galactose metabolism
pgb00500  Starch and sucrose metabolism
pgb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    H744_1c0357
   00500 Starch and sucrose metabolism
    H744_1c0357
Enzymes [BR:pgb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     H744_1c0357
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Other DBs
NCBI-ProteinID: AJR05382
UniProt: A0A0C5WGQ8
LinkDB
Position
1:419383..421032
AA seq 549 aa
MNMTPKWWHDAVVYQIYPRSFCDSNNDGMGDLQGIISKLDYLKSLGVNVLWLSPVYKSPM
DDNGYDISDYQDIAPEFGTMEDMDKLLAEAKKRDIRIIMDLVVNHTSDEHPWFVEARKSK
DNPYRDYYVWRQPAEDGGVPDEMGSVFGGSGWEFDEQTGEYFLHIFSKRQPDLNWENPKV
QEEVHKMMNWWIDKGIGGFRLDVIDLIGKEIDKKITGNGPRLHPLIQQMNRATFGDKDLL
TVGETWDATPEIAKLYSDPAREEFSMVFQFEHISLTWKHGDKWQPIPLDLPTFKKVLTKW
QVELADEGWNSLFWNNHDLPRVVSKYGCDGQYRVESAKMLATTLHMMKGTPYIYQGEEIG
MTNVAFDSIDEYRDIETLNFYKERTENGVAPETMLAAVHENSRDNGRTPMQWNDSTNGGF
SSVAPWIKVNPNYPEVNVSAALDDQNSVFYHYQKLIELRKSMPVIVYGEFEPVFEEHEKV
FGYVRSDAQQRLFVLNNFTSDAITLDLPDHLQAEQVECVIANYEYPQALPASISLKPYES
FAVLLPESR
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgaacatgacgcctaaatggtggcacgatgccgtcgtataccagatctacccgcgcagc
ttctgcgacagtaacaatgatggcatgggggatcttcagggaattatcagcaagctggat
tacctgaaaagcttgggtgtgaatgtcctgtggttgtcgccggtgtataaatcgccaatg
gatgacaatggctatgatatttctgactatcaggatatcgctccggaatttggcaccatg
gaggacatggacaaattgctcgcggaagctaaaaagcgtgacatccgaattatcatggat
ttggtggtcaaccacacttccgatgagcatccttggtttgtcgaagcccgtaaatcgaaa
gacaatccttatcgagactactacgtttggcgtcaacctgccgaagacggcggtgtaccg
gatgaaatgggctctgtatttggcggcagcggctgggaattcgatgagcagaccggtgag
tacttcctgcatattttctccaagcgccagccggacttgaactgggaaaacccgaaggtc
caagaagaagtccataagatgatgaactggtggatcgataaggggatcggtggtttccgt
ttagatgttatcgaccttattggtaaggaaatcgacaagaaaatcaccggcaacggccca
cgcctgcacccgcttatccagcagatgaaccgcgctacttttggtgataaagatcttctg
actgtgggtgaaacttgggatgcgacacctgagattgccaaactgtacagcgatccggct
cgcgaagaattttcgatggtgttccaattcgagcacattagcctgacctggaagcatgga
gataagtggcagccaatcccgctggatctcccaaccttcaagaaggtattgaccaaatgg
caagtagaactggctgacgaaggctggaactccttgttctggaataatcatgatttacct
cgcgtggtatcgaaatacggctgtgatggccagtatcgtgtcgaatcggccaaaatgttg
gcgacaacgctgcatatgatgaaaggcacaccttacatttaccaaggtgaagagatcggc
atgacgaatgtcgcctttgacagtattgacgaataccgagatatcgagacgctgaacttc
tacaaagagcgtaccgaaaatggtgtggcaccagaaactatgttggcagcggttcatgag
aacagccgcgataacggtcgtacaccgatgcagtggaacgacagcactaacggtggtttc
tcgtctgttgcgccttggatcaaggtgaatccgaactaccctgaggtgaatgtcagtgca
gcactggatgaccaaaattccgtgttctatcactaccagaagttgattgagttgcgtaag
tcgatgcctgtcattgtatatggcgagtttgagcctgtgtttgaagagcatgaaaaggtc
tttggctatgttcgctcggatgctcaacagcgcttgtttgtgctcaacaactttacctcg
gatgcgatcaccttggatttgcccgaccatctgcaagcagagcaggtcgaatgtgtgatc
gcaaactatgaataccctcaagcactgccagcatcgatatcgcttaaaccgtatgagtct
tttgctgtcttgctacctgaaagtcgttaa

DBGET integrated database retrieval system