KEGG   Pluralibacter gergoviae: LG71_01710Help
Entry
LG71_01710        CDS       T03300                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00250  Alanine, aspartate and glutamate metabolism
pge00410  beta-Alanine metabolism
pge00640  Propanoate metabolism
pge00650  Butanoate metabolism
pge01100  Metabolic pathways
pge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LG71_01710
   00650 Butanoate metabolism
    LG71_01710
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG71_01710
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LG71_01710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pge01007]
    LG71_01710
Enzymes [BR:pge01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LG71_01710
Amino acid related enzymes [BR:pge01007]
 Aminotransferase (transaminase)
  Class III
   LG71_01710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIQ98694
UniProt: A0A089QW54
LinkDB All DBs
Position
complement(364396..365661)
Genome map
AA seq 421 aa AA seqDB search
MNNAELNQRRLQATPRGVGVMCDYYAQKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VIAAIEAQLKAFTHTAYQIVPYESYVTLAERINDLAPIDGPAKTTFFTTGAEAVENAVKI
ARAYTRRPGIITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGIYPNAAHGVTTD
EALNSLERIFKADIAPDQVAAIVVEPVQGEGGFNVAPPAFMQGLRALCDTHGILLVADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGMPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRANQLGQHLKEVLEHARQSCPAIADIRGQGSMVAVEFND
PATGKPSAEFTKQVQDKAKQEGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgcagaactgaaccagcgccgtttacaggccaccccgcgcggcgtcggggtg
atgtgcgactactatgcgcagaaggcagaaaacgccacgctgtgggatatcgaaggcaat
gaggtaattgattttgccgccgggatcgccgtgctcaacaccggccaccgccatccgaaa
gtgattgcggccattgaggcccaactgaaggcctttacccacaccgcctaccagattgtt
ccctacgagagctacgttaccctggccgagcgcatcaacgacctggcgccgatcgacggc
ccggcgaaaaccaccttcttcaccaccggcgccgaagccgtagagaacgcggtgaagatt
gcccgcgcctatacccgccgtcccggcatcatcaccttcggcggcggcttccacggccgc
accttcatgaccatggcgctgaccggcaaagtggcgccgtacaagattggcttcggcccg
ttcccgggttcggtctatcacggtatctatccgaacgcggcccacggcgtcaccaccgac
gaggcgctgaatagcctggagcgcattttcaaagccgatatcgccccggatcaggtggcg
gctatcgtggtggagccggtgcagggcgagggcggcttcaacgttgcgccgccggcgttt
atgcagggcctgcgcgcgctgtgcgacacccacggcatcctgctggtggccgatgaagtg
cagaccggctttgcccgcaccggcaagctgtttgccatgcagcactatgacgtcaagccg
gacctgatgacgatggccaagagcctggccggcgggatgccgctctccggcgtggtcggc
cgcgccgaggtgatggacgccccggcgcccggcggtctcggcggcacctacgccggtaac
ccgctggcggtggcggcggcgcacgcggtgctggacgtgatcgaagaggagcagctgtgc
cagcgcgccaaccagctgggccagcatctgaaagaggtgctggagcacgcccgccagtcc
tgcccggcgattgccgatattcgcggccaggggtcgatggtggcggtggagtttaacgac
ccggccaccggcaagccgtcggcggagttcacgaagcaggtgcaggacaaagcgaagcag
gaagggctgctgctgctgagctgcggcgtctacggcaacgtgattcgcttcctctatccg
ctgaccattcccgacgcgcagttcaccaaagcgctggatattctggcgcgcgtactgaag
ggctga

DBGET integrated database retrieval system