KEGG   Pluralibacter gergoviae: LG71_09165Help
Entry
LG71_09165        CDS       T03300                                 

Definition
(GenBank) phosphoenolpyruvate--protein phosphotransferase PtsP
  KO
K08484  phosphotransferase system, enzyme I, PtsP [EC:2.7.3.9]
Organism
pge  Pluralibacter gergoviae
Pathway
pge02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:pge00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LG71_09165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pge02000]
    LG71_09165
Enzymes [BR:pge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     LG71_09165
Transporters [BR:pge02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    LG71_09165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N GAF GAF_2 PEP-utilizers GAF_3
Motif
Other DBs
NCBI-ProteinID: AIR00055
UniProt: A0A1S2BKZ2
LinkDB All DBs
Position
1913793..1916039
Genome map
AA seq 748 aa AA seqDB search
MLTRLREIVEKVASAPRLNEALDILVTEICKAMETEVCSVYLADHDRRCYYLMATRGLKK
PRGRTITLAFDEGIVGLVGRLAEPINLADAQKHPSFKYIPSVKEEKYRAFLGVPIIQRRQ
LLGVLVVQQRELRQFDESEESFLVTLATQMAAILSLSQLTALFGQYRQTRIRALAASSGV
GIAEGWMDATLPLMEQVYEASTLDTALERERLTGALEEASSEFRRYSKRFAAGAQKETAA
IFDLYSHLLSDPRLRKELFEEVDKGFVAEWAVKTVIEKFAAQFAALTDGYLKERAGDLRA
LGQRLLFHLDDTTQAADTWPERFVLVGDELSATTLAELPQDRLAGVVVRDGAANSHAAIM
VRALGIPTVIGAEIQPSVLHGRMLVVDGYRGEVLVDPEPVLLHEYQRLISEENELSRLAE
DDVERPAALKSGERIKVMLNAGLSPEHEQKLGSRIDGIGLYRTEIPFMLQSGFPSEEEQV
AQYQGMLQMFNDKPVTLRTLDIGADKQLPYMPISEENPCLGWRGIRITLDQPEIFLIQVR
AMMRANAATGNLSILLPMVTSIEEIDEAKRLIERAAREVEEMIGYEIPRPRIGVMLEVPS
MVFLLPHLANRIDFISVGTNDLTQYLLAVDRNNTRVANIYDSLHPAVLRALSMIAQDADR
YDLDLRLCGEMAGDPMCVTLLVGLGFRHLSMNGRSVARVKYLLRHVDLEEAQTLARRSLE
AQMATEVRHQVAAFMERRGMGGLIRGGR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgctcacccggttgcgagagatcgtcgagaaagtagccagcgccccgcgtctgaacgag
gcgctggacattctggttaccgaaatttgcaaagcgatggagaccgaggtgtgctcggtc
tacctggccgatcacgacaggcgctgctactacctgatggcgacccgcggcctgaaaaag
ccgcgcgggcgcaccatcacgctggcctttgacgaagggatcgtcggcctggtcgggcgg
ctggcagagccgattaacctcgcggacgcgcagaagcaccccagctttaaatacatcccc
tcggtaaaagaggagaagtaccgcgctttcctcggcgtgccgattatccagcgtcgccag
cttcttggcgtactggtggttcagcagcgcgagctgcgccagtttgacgaaagcgaagag
tcgttcctcgtcacgcttgccactcagatggccgccattctttctctttcccagcttacc
gcgctgttcggccagtaccggcagacgcgcattcgcgcgctggcggcctcctccggggtc
ggcattgccgaaggctggatggacgccacgctgccgctgatggagcaggtctacgaagcc
tccaccctcgacaccgcccttgagcgcgagcggctgaccggcgcgctggaagaggcttcc
agcgagtttcgccgctacagcaaacgctttgccgccggggcgcagaaagagacggcggcg
atttttgacctctactcccacttgctctccgatccgcggctgcgcaaggagctgtttgaa
gaggttgataagggctttgtcgccgaatgggcggtcaaaaccgtcattgaaaagtttgcc
gcccagttcgcggccctgaccgacggctatcttaaagagcgcgccggcgatctgcgcgcg
ctcggacagcggctgctgtttcatctcgatgacacgacgcaggcggcggacacctggccc
gagcgctttgtgctggtgggcgacgagctgtcggccaccacgcttgccgagttgccgcag
gaccggctcgccggcgtggtggtgcgcgacggcgcggccaattcgcacgccgcgatcatg
gtgcgggcgctcggcattccgacggttatcggcgctgagattcagccctccgtactgcac
gggcggatgctggtggtggacggctaccggggcgaagtcctcgtcgatcctgagccggtg
ctgctccacgagtaccagcgcctcatcagcgaagagaacgagctcagccggctggcggaa
gatgacgtcgagcgcccggcggcgctgaagagcggcgagcggatcaaagtgatgctcaac
gccggcctcagtccggagcacgagcagaagctcggcagccgcatcgacggcatcggcctg
tatcgcaccgaaataccctttatgctgcaaagcggctttccctcggaagaggagcaggtc
gctcagtatcagggcatgctgcagatgtttaacgacaagccggtgacgctgcgtacgctg
gacatcggcgccgacaagcagctgccgtacatgccgatcagcgaagagaacccctgcctg
ggatggcgcgggatccgcatcacgctcgatcagccggagatctttctgatccaggtgcgc
gccatgatgcgcgccaatgcggccaccggcaatctcagcatcctgctgccgatggtgacc
agtatcgaagagatcgacgaagctaagcggctgatcgaacgcgcggcccgcgaagtggag
gagatgatcggctatgagatcccgcgtccgcgcattggcgtaatgctggaggtgccgtcg
atggtcttcctgctgccgcacctggcaaaccggatcgactttatctccgtcggtaccaac
gatctgacccagtatctgctggcggtggatcgtaacaatacccgggtggcgaacatttac
gacagtttgcatccggcggtgctgcgggcgttgtcgatgatcgctcaggatgcggatcgc
tacgatctcgatctgcgcctgtgcggcgagatggccggggacccgatgtgcgtgacgctg
ctggttggcctcggcttccgccatctgtcgatgaacgggcgttcggtggcgcgggtcaag
tatctgctgcgccacgtcgatctcgaagaggcgcagacccttgcccggcgaagccttgag
gcgcagatggcaacggaggtgcgccaccaggtggcggcctttatggagcgtcgcgggatg
ggcggcctgattcgcggcggccggtag

DBGET integrated database retrieval system