KEGG   Paraburkholderia graminis: CUJ91_22875Help
Entry
CUJ91_22875       CDS       T05548                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pgp  Paraburkholderia graminis
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CUJ91_22875
Enzymes [BR:pgp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CUJ91_22875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Glutaredoxin K_oxygenase Thi4 FAD_oxidored FAD_binding_3 DAO NAD_binding_8 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AXF10784
LinkDB All DBs
Position
PHS1_B:1045974..1047566
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKTYLEKVSNPIEIVASLDDSAKSQELLALLNDIATLSERVTVIERRGDSE
RKPSFSIGEPGKDIGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDTNAGARAAKELENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYEVDIMDVQRADALIPGRINE
VRLANGAVLKARTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLFEFGATLRADEVLQRKLRSLANVTIVTQAQTTEITGDGKKV
NGLVYKDLRSGEVKKVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSEETEAVSEVEAEATV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatctcaagactcagttgaaaacgtacctcgaaaaggttagtaaccct
atcgagatcgtcgcgtcgctcgacgacagcgcgaaatcgcaagagctgctggcattgctg
aacgatatcgcgacgttgtcggaacgcgttaccgtcatcgaacgccgcggcgacagcgaa
cgcaagccgtcgttctcgatcggcgagccgggcaaggacatcggcatccgtttcgcgggc
attccgatggggcatgaattcacgtcgctcgtgcttgcgttgctgcaggtcggcggccat
ccggtcaagctcgacgacgcggtgatcgaacagatccgcagtctcgacggcgactatcaa
ttcgaaacgtatttctcgctgtcatgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcgttgatcaacccgcgcattcgccacgtggcgatcgacggcgcgctgttccag
aacgaagtcgaagcgcgccagatcatggctgtgccgaccatgttcctgaacggcgaagtg
ttcggccagggccgcagcggcgtgaaggaaatcctcgcgaagctcgacacgaatgccggc
gcgcgtgccgcgaaggaactggaaaacaagccggtgttcgacacgctgatcgtcggcggc
gggccggctggcgcggctgcggcgatctattcggcgcgcaagggcatcgcgacaggcgtc
gtcgcggaacgcttcggcggccaggtgctcgatacgctcgcgattgagaacttcgtgtcc
gtcaccgagaccgaaggaccgaagttcgccaccgcgctcgagcagcacgtcaagacgtat
gaagtcgacatcatggacgtgcagcgcgccgacgcgctgattcccggccgcatcaacgaa
gtgcgtctcgcgaatggcgcggtgctgaaggccagaacgatcattctcgcgacgggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtaccgcaatcacggcgtcgcgtac
tgcccgcactgcgatggcccgctcttcaagggcaagcgtgtcgcggtgatcggcggcggc
aactcgggcgtggaagcggccatcgacctcgcgggcatcgtgcgcgaagtgacgctgttc
gaattcggcgctacgttgcgtgccgacgaagtgctgcaacgcaagctgcgcagcctcgcc
aacgtgacgatcgtcacgcaggcgcagactaccgaaatcaccggcgacggcaagaaggtc
aacggtctcgtctacaaggatctgcgttcgggcgaagtgaagaaggttgagctggaaggc
gtgttcgtgcagattggtctcgtgccgaacaccgaatggctgaagggcacggtcgagttg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgccgggcgtgttc
gcagccggcgacgtgaccacggtgccgttcaagcagatcgtgattgcggtcggtgagggc
gcgaaggcatcgctcagcgcgttcgatcatctgatccgcaacagcgaggaaacggaagcg
gttagcgaggtggaagccgaagcgacggtttga

DBGET integrated database retrieval system