Proteus hauseri: PH4a_14410 Help Entry PH4a_14410        CDS       T05854                                  Name (GenBank) murein lipoprotein   KO K06078   murein lipoprotein Organism phau  Proteus hauseri Brite KEGG Orthology (KO) [BR:phau00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01011 Peptidoglycan biosynthesis and degradation proteins [BR:phau01011]     PH4a_14410 Peptidoglycan biosynthesis and degradation proteins [BR:phau01011]  Peptidoglycan biosynthesis and degradation   Structural protein    PH4a_14410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LPP Alanine_zipper TolA_bind_tri COG6_N Filament TPR_MLP1_2 DUF677 DUF3138 NPV_P10 V-SNARE YlqD MbeD_MobD DUF948 Motif Other DBs NCBI-ProteinID:  QAV24464 UniProt:  A0A410XD84 LinkDB All DBs Position complement(3162884..3163120) Genome browser AA seq 78 aa AA seqDB search MKAKLVLGAVIVASSLLAGCSSNNAQLDQISSDVSRLNTQVQQLSGDVQSARAEAKSAYD EAARANQRLDNQVTTYKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaaagcgaaactagtactgggtgcggtaattgtggcttcgagcttattagcaggttgc tccagcaacaatgctcaattagatcaaatctcttctgatgtaagccgtttaaatacacaa gttcagcagttaagcggtgatgtacagtctgctcgtgctgaagctaaatcagcttacgac gaagccgctcgtgcgaatcagcgtttagataaccaagttactacttataaaaagtaa

DBGET integrated database retrieval system