KEGG   Providencia heimbachae: NCTC12003_02105Help
Entry
NCTC12003_02105   CDS       T05509                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
phei  Providencia heimbachae
Brite
KEGG Orthology (KO) [BR:phei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC12003_02105 (ahpF)
Enzymes [BR:phei01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC12003_02105 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_binding_3 AlaDh_PNT_C DAO Thi4 NAD_binding_8 FAD_oxidored NAD_binding_7 K_oxygenase FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: SQH13385
LinkDB All DBs
Position
1:complement(2342452..2344026)
Genome map
AA seq 524 aa AA seqDB search
MLDNNLQAQLKAYLEKLTKPLELVANLDSSEKSNEIKQLIEQIASLSDKISVREVHDKSL
RMPSFLITNPGVDSGVRFAGSPLGHEFTSLVLALLQVGGHPSKEAQELLEQIKSLEGEFH
FETYYSLSCHNCPDVVQAFNLMAILNPNISHTAIDGALFQNEIEERNVMGVPAVFLNGKE
FGQGRMTLSEIVSKVDTKADERAAKSLTEREPFEVLIIGSGPAGASAAIYTARKGIRTGV
IGERFGGQVMDTVDIENYISVIKTEGAIFAGALKNHVDNYDVDVIDGQSVTKLIPAEQAG
GLHQIETASGGILKSRSIIISTGARWRNMGVPGEQEYRTKGVTFCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGIVEHVTVLEFAPELKADSVLQQKARSLKNIDIILNAQTLEVKGD
GSKMTSLEYKDRTNETVHSLAVAGAFVQIGLLPNTNWLGDTITRNRIGEIEVDARGETNI
KGIFAAGDCTTVPYKQIIISAGEGAKAALSAFDYLIRTSTRTAE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataataatttacaggcacaattgaaagcctatttagaaaaattaactaaacct
ttagagttagttgcaaatttagatagcagcgaaaaatcaaatgaaataaaacaattaatt
gaacaaattgcttcgctatcagacaaaattagtgttcgtgaagttcatgacaaatcatta
agaatgccatcatttctaattactaatccaggtgtggatagtggtgttcgctttgcgggt
tccccactaggacatgaatttacttctcttgttttagcattattacaagttggtggacat
ccatcaaaagaagcacaagaactattagaacagattaaaagccttgaaggcgaatttcat
ttcgagacttattattcattatcgtgccataactgcccagatgttgttcaagcatttaat
ttaatggcgattttgaacccaaatatcagccatacggcgattgatggcgcgcttttccaa
aatgaaattgaagaacgcaatgtgatgggcgtccccgctgttttcttaaacggaaaagaa
tttgggcaagggcgcatgacattaagtgaaattgtcagcaaggttgatactaaagccgat
gagcgtgcggcaaaatcattgaccgaacgtgagccatttgaagtattgattattggtagt
ggtcccgcgggagcttctgctgccatttataccgctcgtaaaggcattcgtactggcgtg
attggcgagcgctttggcggccaagttatggatacggttgatattgaaaactatatttct
gtgattaaaacagaaggtgcgatatttgccggtgcattaaaaaaccatgtagataattat
gatgtcgatgtcattgatggtcagtcagtgactaaattaatccccgcagaacaagcgggt
ggcttacatcaaattgaaaccgcatcaggtggtatcttaaaatcacgcagtattattatt
tcaaccggcgcacgttggagaaacatgggtgtaccgggggagcaagaatatcgtaccaaa
ggggtaacattctgcccacactgtgatggccctctatttaaaggcaagcgagttgcggtg
attggtggtggtaactcaggcattgaagccgcgattgatttagccggtattgttgaacac
gtgactgtgcttgagtttgcaccagaactgaaagcggattcagtattgcaacaaaaagcg
cgtagtttaaaaaatatcgatatcattttgaacgcacaaaccttagaagttaaaggtgat
ggtagcaagatgacgagccttgaatataaagatcgtactaatgaaacagtgcattcttta
gccgtggctggcgcattcgtacaaattggtttattacccaataccaactggttaggggat
acaattacccgtaatcgcataggtgaaattgaagttgacgctcgtggtgaaaccaatatt
aaaggtatttttgctgcaggtgactgtaccactgttccttataagcaaatcattatttca
gccggagaaggcgcaaaagccgcacttagcgcatttgactacctaatccgcacaagtacc
agaaccgctgaatag

DBGET integrated database retrieval system