KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099939
Entry
102099939         CDS       T02921                                 

Gene name
EFCAB7
Definition
(RefSeq) EF-hand calcium binding domain 7
  KO
K23852  EF-hand calcium-binding domain-containing protein 7
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102099939 (EFCAB7)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DUF4950 EF_assoc_2 EFhand_Ca_insen
Other DBs
NCBI-GeneID: 102099939
NCBI-ProteinID: XP_005521283
LinkDB
Position
Un
AA seq 623 aa
MASTPGNQKATHLENSQGKKSQHAEEAIFYMNCRAAYLTVLKSSLENIKSKEQLSLALQQ
AGRNPSQKTINKYWTSQTTSLNFDDFCAILKKEKPATKNELLEAFGKIDTDKSGYILHDE
LFKILTTRGDKMTWEEVTSITKQADFNCSGKLDYSKFCELYLTTSEQCCKAARDRLETDP
RLRQQHFGNQTEHFSHGITLPASKASPRVSRKTDHKLAKGDSRAPSRPSSAQSSKASTST
TVTVSASSSRNTKLIIEPDTMKEWQCAQSKGCFYLEEDGEIISHKYRLHLPQRSAVCVTI
KPFTVPQAEGKSCHWLSVDTALFILKENETQENLQLVSFTELQNKEVFGWRGELGAGVYW
LLPFTTGCRLRKVKTQITGEAELVWRDEDGELALTREFRATLLDIFETIDLDGNGLLSLE
EYNFFELRTSGEKCDQEAWAVCKENFEMKKNELTRQGFLDLNLMEANDRDGDPWDLWVTL
LSLGYNKALEMTEACPFVIDISAERCKPRIKAISLEAGGSQLSRAVCRSVVIKGEAKVLD
GSENIFIYTYRSGSRITSVIENKSENKVIIHVNNEQSKNCLNSRGLTVFAVEVAPKSMMV
SQHVMALNEQEEWIYSCVHSLVC
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggccagcactcctgggaatcagaaagccacacacttggaaaattcccaagggaagaag
tcccagcatgcagaagaagccattttttacatgaactgcagagcagcttatctgactgtc
ttaaaaagcagcttagaaaatattaaatcaaaagaacagctcagtttagcacttcaacaa
gctggaagaaatccttctcagaagactattaacaaatactggacttcacaaacaacttca
ctgaattttgatgatttttgtgctattttaaaaaaagaaaagccagctacaaaaaatgaa
ctactcgaagcatttggaaaaatagacacagataagtctggatatattttacatgatgaa
ctttttaaaattcttacaacaagaggtgataaaatgacctgggaggaagtaaccagcatt
actaaacaagctgattttaactgcagtggcaaacttgactacagcaagttctgtgagctg
tacctgaccaccagtgagcagtgctgcaaagctgcaagggacaggctggaaactgaccct
cggctgaggcagcagcactttgggaatcaaactgaacatttctcccatgggatcacactg
ccagcgtcaaaagcatccccaagagtctccaggaaaactgatcacaaattggccaaaggt
gacagcagagctccttcaagaccttcatcagctcaaagcagcaaagcttccacctccacc
actgtgactgtgagtgccagcagcagcaggaacacaaagctaattattgagcctgacaca
atgaaggaatggcaatgtgcacagtccaaaggctgcttctacctggaggaagatggggaa
atcatcagtcacaagtacaggctacacttaccccaaagatctgcagtttgtgtcaccatc
aaacctttcactgttccccaggcagaaggaaaatcttgtcactggttgtcagtggataca
gctttgtttattctgaaggaaaatgaaacacaagagaatctacagcttgtgagctttact
gaactccaaaacaaagaggtgtttggctggagaggggagcttggagctggagtttactgg
ctgctccctttcacaactggctgcaggctgagaaaggtgaaaacccaaattactggagaa
gcagaactggtgtggagggatgaagatggagagctggctctcaccagagaattccgagct
actttgttggatatatttgaaacaattgatttggatggcaatggcctcctgagtctggag
gaatacaacttctttgagctgaggactagtggggagaagtgtgatcaggaagcctgggca
gtgtgtaaggagaattttgagatgaagaagaatgaactaacaagacaaggatttctggat
ttgaatctcatggaagccaatgaccgggatggggatccttgggacctttgggtcactttg
ttgtccctgggctacaacaaagccttagaaatgacagaggcctgcccctttgtcattgac
atcagtgcagagaggtgcaaacccagaattaaagccatttctctggaggcagggggctcc
cagctcagcagggctgtctgcaggtctgtggttattaaaggagaggccaaagtgctggat
ggctctgagaacatcttcatctacacctacagatctggcagcagaatcacctctgtgatt
gaaaataagtctgaaaataaagtgataattcatgtcaacaatgagcagagtaagaactgc
ctaaacagtaggggactgacggtttttgccgtggaagtggctccaaaatccatgatggtc
tctcagcacgtgatggccctgaatgagcaggaagagtggatttacagctgtgtgcactcc
cttgtatgttaa

DBGET integrated database retrieval system