KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100694
Entry
102100694         CDS       T02921                                 

Gene name
SPOP
Definition
(RefSeq) speckle type BTB/POZ protein
  KO
K10523  speckle-type POZ protein
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102100694 (SPOP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phi04121]
    102100694 (SPOP)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     102100694 (SPOP)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 102100694
NCBI-ProteinID: XP_005532521
LinkDB
Position
Un
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFKGHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVMETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtccagggtgccgagtcccccccctccggcagagatgtccagcgggcccgtggccgag
agctggtgctacacccagatcaaggtggtgaagttctcctacatgtggaccatcaacaac
ttcagcttctgccgggaggagatgggggaggtcatcaagagctcgaccttttcctccgga
gccaacgacaagctcaagtggtgtttacgtgtcaaccccaagggcctggacgaggagagc
aaggattacctgtcgctgtacctgctgctggtcagctgccccaagagcgaggtcagggcc
aagttcaagttctccatcctcaacgccaagggagaggagaccaaggccatggagagccag
cgcgcctatcgcttcgtgcaaggcaaggactggggcttcaagaagttcatcaggagagat
ttcctgctggacgaggccaacgggctgctgccagacgacaaactgaccctgttctgtgag
gtgagcgtggtgcaggactcggtgaacatctcggggcagaacaccatgaacatggtgaag
gtgcccgagtgccgcctggccgacgagctgggcgggctctgggagaactcgcgcttcacc
gactgctgcctctgcgtggccggccaggagttcaagggccacaaagccatcctggcagcg
cgctccccggtcttcagcgccatgttcgagcacgagatggaggagagcaaaaagaaccgt
gtggagatcaacgacgtggagcccgaggtttttaaggagatgatgtgtttcatctacacc
gggaaggccccgaacctggacaagatggctgatgatctgctggcagctgctgacaagtac
gccctggagaggctgaaggtgatgtgtgaggatgctctctgcagtaacctgtccgtggag
aacgcggccgagatcctgatcctggctgacctgcacagcgcggaccagctcaaaacccag
gccgtggacttcattaattaccacgcctcggacgtgatggagacgtcgggctggaagtcc
atggtggtgtcccaccctcacctggtggccgaggcctatcgctcgctggcctcggcgcag
tgcccgttcctgggcccgccccgcaagcggctgaagcaatcctaa

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114473
Entry
102114473         CDS       T02921                                 

Gene name
SPOPL
Definition
(RefSeq) speckle type BTB/POZ protein like
  KO
K10523  speckle-type POZ protein
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102114473 (SPOPL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phi04121]
    102114473 (SPOPL)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     102114473 (SPOPL)
SSDB
Motif
Pfam: BTB MATH
Other DBs
NCBI-GeneID: 102114473
NCBI-ProteinID: XP_005519656
LinkDB
Position
Un
AA seq 392 aa
MSRVPTPPPPGEMSSGPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQSNTNTLK
VPECRLAEDLGNLWETTRFTDCSFYVGGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNR
VEINDVDPEVFKEMMRFIYTGKAPNLEKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADILILADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETAGWKSMI
HSHPHLVAEAFRALASAQCPQFGIPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcaagggttcccaccccacctcctcctggggagatgtccagtggacctgtggctgaa
agctggtgttacacacaggttaaagtagtaaaattttcatacatgtggaccattaataac
ttcagtttttgccgtgaagaaatgggtgaagttttaaagagttctacattttcatcaggg
ccaaatgacaaaatgaagtggtgcctgagagtgaatccaaagggattagatgatgaaagc
aaagactacttgtcattgtatttgcttttagtcagttgtccaaaaagtgaagtcagagca
aaattcaaattttccctgctgaatgctaaaagagaagaaacaaaagcaatggaaagccaa
agagcatatcgatttgtgcaaggcaaggactgggggtttaagaaatttatccgaagagat
tttttactagatgaagctaatggtcttctaccagatgacaagcttacattattctgtgag
gtaagcgtggtccaagactcagtaaatatatcaggacagtctaatacaaacactttgaag
gtacctgaatgtcgactagcagaagatttagggaatctctgggaaacaacaagatttaca
gattgcagtttttatgtaggaggacaagaattcaaagctcataaatctgtccttgcagca
cgatctccagtttttaatgcaatgtttgaacatgaaatggaggaaagcaaaaagaatcgt
gtagaaataaatgatgtagaccctgaagtttttaaagaaatgatgagattcatttacaca
ggaaaagcaccaaaccttgaaaaaatggctgacaatttgttggcagctgcagacaaatat
gcactggaacggctgaaggtgatgtgtgaggaggcactctgtagtaacctctcggtagaa
aatgttgctgacattcttatcctcgcagatttgcacagcgctgaacagctaaaagcacaa
gcaatagactttattaacaggtgcagtgttcttagacaacttgggtgtaaagatgggaaa
aactggaatagcaaccaagcaacagacataatggaaactgcaggctggaagtccatgatc
cactcccaccctcacttagtagccgaggcctttcgcgctctggcgtctgcacagtgtcca
cagtttggcattccacgcaagcgactaaaacagtcctga

DBGET integrated database retrieval system