KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102103421
Entry
102103421         CDS       T02921                                 

Gene name
SUFU
Definition
(RefSeq) SUFU negative regulator of hedgehog signaling
  KO
K06229  suppressor of fused
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102103421 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 102103421
NCBI-ProteinID: XP_005520755
LinkDB
Position
Un
AA seq 486 aa
MEGVRPGGGHPAGGPGSGPGSASGSGSFPSLFPPGLHGIYGECRRLYPDQPNPLQVTAIL
KYWLGGPDPLDYVSMYRNLGNPALNVPEHWHYVSFGLSDLYGDNRVHEFTGTDGPSGFGF
ELTFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHML
LTEDPQMQPVQTPFGVVTFLQIVGVCTEELHAAQQWNGQGILELLRTVPVAGGPWLITDM
RRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPR
RLSGKDTEQIRETLRRGLEINSKPVLPPINAQRQNGLNLDRAPSRKDSLESESSAAIIPH
ELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDTAITFVSTGVEGAFA
TEEHPYAAHGPWLQILLTEEFVERMLEDLEDLNSPEEFKLPKEYSWPEKKLKVSILPDAV
FDNPLH
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggagggcgtgcggccgggcggggggcaccccgcgggcgggccagggtccggcccgggg
tctgcgtctgggtccgggtccttcccgtcgctgttcccgccggggctgcacggtatctac
ggcgagtgccgccgcctctaccccgaccagcccaacccgctccaggtcaccgccatcctc
aagtactggttgggaggacctgaccctctggactatgttagcatgtacagaaacctggga
aacccagcactgaatgttcctgagcactggcactatgtcagttttgggttaagtgatttg
tatggagacaacagagttcatgagtttacaggaacagatggaccgagtggttttgggttt
gagctgacattccgactgaagagagagacgggggagtcggcaccacccacttggccagca
gagctgatgcaaggcttggccagatatgtcttccagtcagaaaacaccttttgcagcggt
gaccatgtgtcatggcacagtcctttggacaacagtgaatctcgaatccagcacatgtta
ctgacagaagacccccagatgcagccggtgcagactccttttggggtcgttactttccta
cagattgttggggtttgcactgaggaactgcatgcagctcagcagtggaatggtcaaggg
atcttggaactgcttcggactgtcccggtagctggaggcccctggctgataacagacatg
cgaagaggagagactatattcgagattgacccacatctgcaagagagagttgacaaaggg
attgagacagatggctcaaacctgagtggagtgagtgccaaatgtgcctgggatgacctg
agtcggccaccagaggatgatgaagacagcaggagcatttgcattgggacccagcctcgg
cggctctctgggaaagatacagagcaaatcagggagactttgcggagagggcttgagatt
aacagcaaacctgtcctacctccaatcaatgcacaaagacagaatgggttgaacctcgac
cgagcaccaagccgtaaggacagtttggaaagcgagagctcagcagccatcattcctcat
gagctgatccgcacaagacagctggagagcgtgcacctgaaatttaaccaggagtctgga
gcgctcatccccctctgtctaaggggaaggctcttacatggacggcactttacgtataaa
agtattacaggagatacagcaatcacatttgtgtcaacaggagtagaaggagcctttgct
acagaggagcacccctatgcagcccatggaccctggttacaaatcctattgaccgaagag
ttcgtagagagaatgctggaagatttagaagatctgaattctccagaggaatttaaactt
ccaaaggagtacagctggcctgaaaagaaactgaaagtttccatcttgccagatgccgtg
ttcgacaacccactgcattag

DBGET integrated database retrieval system