KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104157
Entry
102104157         CDS       T02921                                 

Gene name
PTCH1
Definition
(RefSeq) patched 1
  KO
K06225  patched 1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102104157 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 102104157
NCBI-ProteinID: XP_005522797
LinkDB
Position
Un
AA seq 1442 aa
MASAGNASEPETSSSAGGGGHPGRAARIGGGRRRRTGGNRSAAAPDREYLQRPSYCDAAF
ALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLRAAN
LETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPQEDGANVLTTEALRQHLE
SALQASRVHVYMYNRQWKLEHLCYKSGELITEAGYMDQIIEYLYPCLIITPLDCFWEGAK
LQSGTAYLLGKPPLQWINFDPLEFLEELKKINYQVESWEEMLNKAEVGHGYMDRPCLNPA
DPDCPITAPNKNSTKPLDVALVLSGGCYGLSRKYMHWQEELIIGGTVKNSSGKLVSAQAL
QTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRMYVEVVHQSVAQNSTQKVL
SFTTTTLDDILKSFSDVSAIRVASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVALS
VAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDL
YRREDRRLDIFCCFTSPCVTRVIQVEPQAYVENDNTCYSPPPPYSSHSFAHETQITMQST
VQLRTEYDPHTQVYYTTAEPRSEISVQPVTVTQDNLSCQSPESTSSTRDLLSQFSDSSIH
CLEQPCTKWTLSSFAEKHYAPFLLKPKAKIVVIFLFLGLLGLSLYGTTRVRDGLDLTDIV
PRETREYDFIAAQFKYFSFYNMYIVTQKADYPNVQHLLYELHRSFSNVAYVLLEEDRQLP
KMWLHYFRDWLQGLQDAFDSDWETGKITYNNYKNGSDDAVLAYKLLVQTGNHAKPIDISQ
LTKQRLVDADGIINPNAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRL
RIPAAEPIEYAQFPFYLNGLRETSDFVEAIEKVRAICNNYTSLGISSYPNGYPFLFWEQY
IGLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIVVVLALMTVELFGMMGLIGIKLSAV
PVVILIASVGIGVEFTVHVALAFLTAIGDRNHRAVLALEHMFAPVLDGAVSTLLGVLMLA
GSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGQDRLPTPSPEPA
PGTVRFALPPGHTNNASDSSDSEYSSQTTVSGISEELHQYEATRGPGAPVHQVIVEATEN
PLFARSTVVQPEARHQPGPRLQSNPEPSTQQPWHQGRQPKREAREGPRPPPHRPRRDAFE
ISTEGHSGPSSRDRLGHKARSHSMRSPAFGAAGAAGAAYCPPITTVTASASVTVAVHPAL
HSHSSRAASFPSFEGHHEAGHAPFEDPHVPFNVRCERRNSKVEVIELQDVECEERIPGNS
SQ
NT seq 4329 nt   +upstreamnt  +downstreamnt
atggcctcggccggtaacgcgtcggagccggagaccagcagcagcgcgggcggcggaggc
caccccggccgggcggcgagaatcggcggcgggaggcggcgaaggactggagggaatcgg
agcgccgcggcgcccgaccgggagtatctgcagcggccaagctactgcgatgcggctttc
gccttggagcagatttcaaaggggaaggcgacgggacggaaagcgccgctgtggctgcga
gcaaagtttcagagactgttgtttaaactgggctgttacattcagaaaaactgcgggaag
tttttggttgtcggcctcctgatatttggggctttcgctgtaggattaagggcagctaat
ctcgagaccaacgtggaggagctgtgggtggaagttggtggacgagtgagtcgggagtta
aattacacacggcagaagattggagaagaagccatgttcaacccccagctcatgatccag
actccacaggaagatggtgctaatgtactaacaacagaagcactacgacagcaccttgag
tctgcacttcaggccagcagagtacatgtctatatgtacaacagacagtggaaattggaa
catttatgttacaaatcaggagaactcatcacagaagcaggttacatggaccagattata
gaatatctttatccttgcttaattatcactcctttggactgcttctgggagggagcaaag
ctacaatcaggaactgcctatctattagggaagcctcctttgcagtggatcaactttgac
cccttagaattcttggaagagttaaagaaaataaactaccaagtggagagctgggaagaa
atgctgaataaagcagaggttggtcatggttatatggatcgaccctgcctgaatcctgct
gatcctgattgcccaatcacagctcccaataaaaattccaccaaacctcttgatgtagcc
cttgttttgagtggtggatgctatggactatcaaggaaatacatgcattggcaggaggag
ctgattataggtggtacagtcaagaacagttctggtaaacttgtcagtgcccaggctttg
caaaccatgtttcagttaatgacccctaagcaaatgtatgagcatttcaaggggtatgaa
tatgtttcacatatcaactggaacgaggacaaggcagcagcaattctggaagcctggcag
aggatgtatgttgaggttgttcatcaaagtgttgcacaaaactctactcagaaggtgctt
tcctttacaacgaccaccctagatgacatcttgaagtcattttctgatgtcagtgctatc
cgagtagctagtggctacttactaatgcttgcctatgcctgcttaacgatgctgcggtgg
gactgtgccaagtctcagggtgctgtggggctggcaggagtcttgttggttgcactctct
gtggctgcaggattgggcctgtgctcattgattggcatttcctttaatgctgccacaact
caggttttgccttttcttgctcttggagttggtgtagatgatgttttccttctggcacat
gcatttagtgaaacaggacagaataagagaattccgtttgaggacagaacaggtgaatgt
ctgaagcgaacaggagcaagtgtagcccttacatctatcagcaatgttactgctttcttt
atggctgccttaattcctattccagctttaagagcattttctctccaagcagcagttgtg
gtggtgttcaattttgctatggttctgctgattttccctgctatcctgagcatggacctt
tatcgtcgagaagacaggagactggacatattttgctgttttacaagcccgtgtgtcacc
agagtgattcaggttgagcctcaagcgtacgtggaaaatgacaatacttgctacagtcct
ccacccccgtacagcagccacagttttgcacatgaaactcagattacaatgcagtccaca
gtgcagttgcgcacagaatatgatcctcacacgcaggtgtactacaccacagcagagcct
cgctcagaaatatctgtgcagccagtgacagtgacacaagataatctgagctgccagagc
ccagaaagcacaagctcgacgagggatttactttcccagttttcagactccagtatacat
tgcctcgagcaaccctgtacgaagtggacactctcatcttttgcagaaaagcattatgct
ccattcctcctgaaaccaaaagctaagattgtggttatttttctttttttgggtttactt
gggctcagcctttatggaactacccgggtgagagatggactagatctcacagacattgta
ccacgggaaacacgggaatatgactttattgctgcacagttcaagtacttttcattctac
aacatgtacattgtgacacagaaagcagactatccaaatgtccagcacttactttatgaa
cttcacagaagtttcagcaacgtggcatatgtcttgttggaagaggataggcagctcccc
aagatgtggttgcactactttcgagactggctgcaaggacttcaggatgcctttgacagt
gactgggaaactgggaagatcacttacaacaactataaaaatggttctgacgatgctgtt
ctggcttacaaactcttggtacaaacaggcaaccatgcaaagcccattgacatcagccag
ttgactaaacagcgtctggtggatgcagatggaatcattaacccaaatgctttctacatc
tacctgacagcctgggttagcaacgaccctgtggcctatgctgcctcacaagccaacatt
cgcccgcaccgcccggagtgggtccacgacaaagcagactacatgccagaaacgcggctg
aggattccagcagccgagcccatagaatatgctcagtttcctttctacctcaatggattg
cgtgaaacttctgactttgtggaggctatcgagaaagtgagagctatctgtaataactac
accagcctggggatctccagctacccaaatggttacccatttctgttctgggagcagtac
attggacttcgtcactggctcctcttatccattagtgtggttttagcttgcacgtttctg
gtgtgtgccctcttcctcctaaacccctggacagctgggatcattgtggtggtgctggct
ctgatgactgtggagctgtttggcatgatgggtctgattggaataaagctgagtgcagtg
cctgtggttatcctgattgcttctgttggcattggtgtggaattcactgttcacgttgct
ttggcgtttttaactgccataggagacaggaaccatagggctgtgcttgcattggaacac
atgtttgcaccagtgctggatggggccgtgtccactctgcttggggtgttaatgcttgca
ggatcagagtttgattttattgtcaggtatttctttgctgttttggcaatcctaaccatt
ctgggagttctcaatggattggtgctgcttcctgttcttctctcattctttggaccatac
cctgaggtatctccagccaacggacaggacagattgcccacaccatctcctgagccagcc
cccggtacagtgaggtttgcactgccacctggccacacaaataatgcttcggattcctct
gattctgagtacagctctcaaaccacagtgtctggcatcagtgaagagctgcatcagtac
gaggccacacgaggccctggggcaccagtccaccaagtaatagtggaagcgactgagaat
cctctctttgcaagatccactgtggttcagccggaagcaaggcatcagccgggtcctagg
ctgcagtcgaatccagagcccagcacgcagcagccgtggcatcagggcagacagcccaaa
cgggaagcgagggaagggccgcgaccacctcctcaccgccctcgcagggacgcttttgaa
atttctaccgaagggcactcgggacccagcagcagggatcgcttgggccacaaggctcgt
tcccacagcatgagaagcccggcattcggggcggcgggcgctgcgggagctgcctactgc
ccgcctatcactactgtgactgcctcggcctcggtcactgttgctgtccaccctgccctg
cacagccacagctcccgggcagcgagcttcccgtccttcgagggacaccatgaagctggc
cacgcgccatttgaggacccccatgtgccttttaatgtgaggtgtgaaagaagaaattct
aaagtagaagtaatagaactgcaagatgttgaatgtgaggaaaggatacctggcaacagc
tcacaataa

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108629
Entry
102108629         CDS       T02921                                 

Gene name
PTCH2
Definition
(RefSeq) patched 2
  KO
K11101  patched 2
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102108629 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing MMPL
Other DBs
NCBI-GeneID: 102108629
NCBI-ProteinID: XP_005521152
LinkDB
Position
Un
AA seq 1348 aa
MPAEPPRAAPPPLRAARRKPLPEVSEGRATPLWLRARFQALLFALGCRIQRHCGKVLFVG
LLVFGALAVGLRVASIETDIEHLWVEAGSRVSQELRYTKEKLGEESVYTSQMLIQTPKKD
GDNILTQEALQLHLEAALAASKVQVSLYGKSWDLNKICYKSGVPIIENGMIERMIEKLFP
CVILTPLDCFWEGSKLQGGSAYLPGRPDIQWSNLDPLQLMEELGQFTSLEGFKELLDKAE
VGQAYMERPCLDPRDPQCPPSAPNKQSQQSPDIPAELSGGCHGFSRKFMRWQQELILGGT
TKDSQGKLLRAEALQTMFLLMSPRQLYEHFKDDYEIHDISWSEEKAGAILEAWQRKFVEL
AQDSIPPNATQSVHAFSTTTLNDIMKSFSDVSVIRVAGGYLLMLAYACVTMLRWDCSKSQ
GAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTETS
QHIPFKERTGECLKRTGTSVALTSVSNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMV
LFVFPAILSLDLHRREKRRLDILCCFYSPCSSRVIQIQPQELADANDNHACHPSPYGHPG
VATSTQITTTVQAFTRCDPSGHHIVTVLPPTSQVCTSPAVLLPHTDPLGSQVFAPSSSTR
DLLSQLDEAKSGRECVPLPFCRWSLADFAREKYAPLLLRTRTKVVVVVLFLALLGLSLYG
TTMVHDGLYLTDIVPRDTKAHAFISAQFKYFSFYNMFIVTKGGFHYPGAQAALLSLHQAF
STVKYVVREGNRDLPKMWLHYFQDWLRGLQATFDRDWQAGRITHDSYRNGSEDGALAYKL
LIQTGNKKEPFNFNQLTTRRLVDENGIIPPDTFYICLTVWASNDPLGFAASQANFYPPPP
EWIHDKYDTTGENLRIPAAQPLEFAQFPFYLSGLRRTSDFVEAIESVRAICREAAQRHGV
LSYPSGYPFLFWEQYIGLRHWFLLAISILLACTFLVCALLLLNPWTAGIIVSILAMMAVE
LFGIMGLMGIKLSAIPVVILIASVGIGVEFTVHVALGFLTAAGSRNVRSAAALEHTFAPV
MDGAVSTLLGVLMLAGSEFDFIMRYFFAVLTILTLLGLLNGLVLLPVLLSVIGPPPEASQ
VDNGPCLPPPESAPPCLGPGGMYVRHTPAWPATFPEPSDTEHYTESIGPGSPRGPFIVPP
APAHILLEAGKDPSFPRITVLKPYKDSLEVQGKKEASGPQHAAPLPFGEPCTMLPREHLQ
SGPPGTRPAPPAALPTYSTHLQGPAGSYTTVTATASVTVALHPTLPGSYPNFTSSERDCL
DEPSTSGTTVPNTFEMQNMGHHGTGARR
NT seq 4047 nt   +upstreamnt  +downstreamnt
atgccggccgagcccccccgcgccgcgccgccgccgctccgcgccgcccgccgcaagccg
ttgcccgaggtgagtgaggggcgagcgaccccgctgtggctgcgggcccgctttcaggcg
ctgctcttcgccctgggttgccggatccagcggcactgcgggaaggtgctcttcgtgggg
ctgctggtgttcggggcgctggccgtgggactacgggtggcctccatcgagaccgacatc
gagcacctctgggtggaagcgggcagccgggtgagccaggagctgcgctacaccaaggag
aagctgggcgaggagtcggtctacacctcccagatgttgatccagaccccgaagaaggat
ggtgataacattctgacgcaggaggccctgcagctccacctcgaggcggccttggccgcc
agcaaggttcaagtctcactgtacggaaaatcgtgggatttgaacaagatctgctacaag
tcgggtgtccccatcatcgagaacggcatgatcgagaggatgatagagaagctgttcccc
tgtgtgatcctgacaccactggactgtttctgggaaggctccaagctgcagggaggatca
gcctatctcccgggccgcccagacatccagtggagcaacctggaccctctgcagctgatg
gaggagctggggcaattcacatccctggaaggcttcaaagagctgctagacaaggcagag
gtgggacaggcttacatggagcggccctgcctggacccccgggacccccaatgtcccccc
agcgcccccaacaagcagagccagcagagccccgacatcccggccgaactctcggggggc
tgccacggcttctccaggaagttcatgcgctggcagcaggagctgattttgggcggcaca
accaaagactcccagggcaagctgctacgcgccgaggccctgcagaccatgttcctcctc
atgagtccccggcagctctatgagcacttcaaggatgactatgagatccatgatatcagc
tggagcgaggaaaaggcaggagccatcctggaggcctggcagaggaaattcgtggagctg
gcacaggactccatccctcccaacgccacacagagtgtccatgctttctctaccaccacg
ctcaacgacatcatgaagtccttctctgacgtcagtgtcatccgggtggctgggggctac
ctcctcatgctggcctatgcctgtgtcaccatgctgcggtgggactgctccaagtcccaa
ggggctgtgggcctggcaggggtcctgcttgtggctctctccgtcgcctctggtctgggg
ctctgctcactgctgggcatctccttcaatgcagccaccacccaggtcctgcccttcctg
gccctcggcattggggtggatgacatgttcctgttggctcacgccttcaccgagacgagc
cagcacatccccttcaaggagcggacgggtgagtgtctgaagcggacagggaccagtgtg
gctctcacctctgtcagcaacatgatcgcctttttcatggcagccctggtgcccatccct
gccctgcgcgccttctccctccaggctgcagtggtggttgtgttcaacttcgccatggtg
ctctttgttttccctgctatcctgagcctggacctgcaccgccgggagaagcgccggctc
gacatcctctgctgcttctacagcccttgctcctcacgggtcatccagatccagccccaa
gagcttgccgatgccaacgacaaccatgcctgtcacccgtctccttatgggcaccccggt
gtggccaccagcacccagatcaccaccactgtgcaagccttcacccggtgtgacccctcg
ggccaccacattgtcaccgtcctaccacccacctcccaagtgtgcacctcacctgccgtc
ctcctgccccacaccgaccccttgggctcgcaggtcttcgccccatccagctccacccgg
gatctgctgtcccagctggatgaggccaagagcgggcgggagtgtgtccccctgcccttc
tgccgctggagcctcgctgattttgcccgggagaagtacgccccactccttctgcgcacc
cggaccaaggtggtagtggtggtgctgttcctggcactgctggggctgagcctctacggc
accaccatggtacatgatggcctctacctgactgacatcgtgccacgggacaccaaggca
cacgccttcatctcagcccagttcaagtacttctccttctacaacatgtttatcgtcact
aagggtggcttccactacccgggtgcccaggctgccctgctgagcctgcaccaggccttc
agcaccgtcaagtacgtggtgcgggagggcaaccgcgacctgcctaaaatgtggcttcat
tacttccaggactggctgcgagggctccaggccacctttgacagggactggcaggctggg
cgcatcacccatgacagctaccgcaatggctccgaggatggggcactggcatacaagctc
ctcatccagactggcaacaagaaggagcccttcaacttcaatcagctgaccacacggcga
ctggtggacgagaatggcatcatcccccccgacaccttctacatctgcctgactgtgtgg
gccagcaacgaccccctgggctttgctgcctcccaggccaacttctaccccccaccccct
gagtggattcatgacaagtacgacaccacgggcgagaacctgcgaatcccagcagcccag
ccgctggagttcgcccagttccctttctacctgagcgggctgcgtcgcacatctgacttt
gtggaggcgattgagagcgtacgggccatctgccgggaggctgcccagcgccacggtgtg
ctgagctaccccagtggctaccccttcctcttctgggagcagtacatcggcctgcggcac
tggttcctgctggccatcagcatcctgctggcctgcaccttcctcgtctgtgccttgctg
ctgctcaacccctggaccgccggcatcatcgtctccatcctggccatgatggctgtggaa
ttgtttggcatcatgggactgatgggcatcaagctgagcgccatccctgtggttatcctc
attgcctcggtgggcatcggtgtggagtttactgtccacgtggccctgggcttcctgaca
gctgcagggagcaggaatgtgcgctcagccgcagcactggagcacacttttgcccctgtg
atggatggtgctgtttccaccctcctcggtgtcctcatgctggctggctctgagtttgat
ttcatcatgaggtatttctttgcggtgctgaccatcctgacgctgctggggctgctcaac
gggctggtgctgctgcctgtcctgctctctgtcatcgggccaccccctgaggcatcccag
gtggataatggcccatgcctacccccaccagagtcagcacccccgtgtctgggccctggg
ggaatgtatgtccggcacactccagcctggcctgccaccttccctgagccctctgacacg
gagcactacacagagagcatagggccaggcagcccacggggacccttcattgtgccccct
gccccggcacacatcctactggaggctggcaaggaccccagcttcccccgcatcactgtc
ctgaagccctacaaggacagcctggaggttcagggaaagaaagaggcttctggccctcag
catgccgcccccctgcccttcggggagccgtgcaccatgctgccccgagagcacctgcag
tccggcccaccgggcacccggccagccccccctgcagccctgcccacctacagcacccac
ctgcagggtcccgccggcagctacaccaccgtcacggccactgcctcagtgactgtggcc
ctgcaccccacactgcctggctcctaccccaacttcaccagcagcgagcgggactgcctg
gatgagccgagcaccagcggcaccactgtgcccaacacctttgagatgcagaacatggga
caccacgggacaggtgcccggcgctag

DBGET integrated database retrieval system