KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109017
Entry
102109017         CDS       T02921                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102109017 (TGFA)
   04012 ErbB signaling pathway
    102109017 (TGFA)
SSDB
Motif
Pfam: DUF1180 EGF_2 FAM176 Trp_oprn_chp
Other DBs
NCBI-GeneID: 102109017
NCBI-ProteinID: XP_005532305
LinkDB
Position
Un
AA seq 156 aa
MAGGPAALALGVLLAACHALDNTTAARNAPVAAAVRSHFNDCPDSHSQFCFHGTCRFLVQ
EDKPACVCHSGYVGTRCEHADLLAVVAANQKKQTITALLVVAVVASALLVTVCVLVHCCR
LRKRCPGWCREHGAGQEKPGGLLKGGTSCCPCETGV
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcgggcggcccggccgcgctcgccctcggtgtcctgctggccgcgtgccacgcgctg
gacaacaccacggccgcccggaacgctccggtggcggcggcggtgaggtcgcacttcaac
gactgccccgactcccacagccagttctgcttccacggcacctgccgcttcctggtgcag
gaggacaaacccgcctgcgtgtgtcactcggggtacgtggggacacgctgtgagcacgct
gacctgctggccgtggtggcagccaaccagaagaagcagacgatcacggccctgctcgtg
gtggccgtggtggcctcggcgctgctcgtcaccgtctgcgtcttggtgcactgctgccgc
ctgcggaagcgctgtccgggctggtgccgggagcacggagccggccaggagaaaccgggg
gggctgctcaaggggggcacgtcctgctgcccctgcgagacaggtgtgtga

DBGET integrated database retrieval system