KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112135
Entry
102112135         CDS       T02921                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04012  ErbB signaling pathway
phi04068  FoxO signaling pathway
phi04110  Cell cycle
phi04115  p53 signaling pathway
phi04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102112135 (CDKN1A)
   04068 FoxO signaling pathway
    102112135 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102112135 (CDKN1A)
   04115 p53 signaling pathway
    102112135 (CDKN1A)
   04218 Cellular senescence
    102112135 (CDKN1A)
SSDB
Motif
Pfam: CDI Orexin_rec2 RNA_pol_Rpb2_3
Other DBs
NCBI-GeneID: 102112135
NCBI-ProteinID: XP_005530210
LinkDB
Position
Un
AA seq 151 aa
MPLSQSRAGQTPCSSKVCRNLFGPVDHEQLQHDFEDKIRQQLEEAQQRWNFDFETETPLE
GPFKWERILVAEQPPQEVHSLVRAVTSSDSRSSLAHRVPPKDHVGRICPEESQQSSKAYK
AGSSQSLKRGQTTIKDFYSAKRRIVPARPRP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccgctgtcccagagcagggctgggcagaccccgtgcagcagcaaggtgtgcaggaac
ctctttggccctgtggaccacgagcagctccagcatgactttgaggacaagataagacag
cagctggaagaagctcagcagcgctggaacttcgactttgagacagagactcccttggaa
gggccgttcaagtgggagaggatcctcgtggctgagcagccgccccaggaggttcacagc
ctggtcagggctgtcaccagcagtgacagcaggagctccttggcccacagggtccccccc
aaggaccatgttggcaggatttgccccgaggagtctcaacagagctcgaaggcttacaag
gctggttcctcgcagagcttgaaacgtgggcagaccacgatcaaagacttctacagtgcc
aagcggaggatcgtccctgcgcggccccggccgtga

DBGET integrated database retrieval system