KEGG   Pangasianodon hypophthalmus (striped catfish): 113533017
Entry
113533017         CDS       T05759                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113533017
   04012 ErbB signaling pathway
    113533017
SSDB
Motif
Pfam: Phage_holin_2_1 Laminin_EGF EGF hEGF
Other DBs
NCBI-GeneID: 113533017
NCBI-ProteinID: XP_026780606
LinkDB
Position
Unknown
AA seq 182 aa
MMYRSFWDTLFLLSGYLFTYSQVRENATSAAATMVMTPTTITATNTTAVSSTGRSKFLAA
AVHSHFADCPDSHSHFCFHGTCRFLIQEETPACVCLPGFIGMRCEHADLLAVVATNQSQQ
TLATILMLGILGSVLLVLLCTIINLWWKRGRCRRGPLLSCLSKKPKGIVKSGTSCCHSET
AV
NT seq 549 nt   +upstreamnt  +downstreamnt
atgatgtatcgctctttttgggatacgttattcctccttagtggctatttatttacatac
agccaagtgcgagaaaatgctacttcagcagcagcaacaatggtgatgactcccaccact
ataactgctaccaacacaacagcagtgtcaagtactggtagaagcaagttcctagcagca
gcagtccactctcactttgctgactgtcctgactctcacagccatttctgcttccacggc
acatgccgcttcctcatccaggaggagacaccagcgtgtgtgtgcctcccaggcttcata
ggtatgcgttgtgagcatgcagacctgctggcagtggtggcaaccaaccagagccagcag
acactggccaccatattgatgctgggcatattgggcagtgtcctgcttgtgctgctttgc
accataataaacttgtggtggaagcggggcagatgtaggcgaggacctctgctttcctgt
ttgtcaaaaaaaccaaagggcatcgtaaagagtgggacgtcctgctgtcactcagagaca
gcagtttga

DBGET integrated database retrieval system