KEGG   Pangasianodon hypophthalmus (striped catfish): 113533395Help
Entry
113533395         CDS       T05759                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp03030  DNA replication
phyp03410  Base excision repair
phyp03420  Nucleotide excision repair
phyp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    113533395 (lig1)
   03410 Base excision repair
    113533395 (lig1)
   03420 Nucleotide excision repair
    113533395 (lig1)
   03430 Mismatch repair
    113533395 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:phyp03032]
    113533395 (lig1)
   03400 DNA repair and recombination proteins [BR:phyp03400]
    113533395 (lig1)
Enzymes [BR:phyp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     113533395 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     113533395 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     113533395 (lig1)
DNA replication proteins [BR:phyp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    113533395 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     113533395 (lig1)
DNA repair and recombination proteins [BR:phyp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     113533395 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     113533395 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     113533395 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 113533395
NCBI-ProteinID: XP_026781330
LinkDB All DBs
Position
Unknown
AA seq 983 aa AA seqDB search
MQRSISSFFQPMKCKEKDGMPKGKSESVKSPLKPQNIDQECDSPVKTSKRNRAIIDSDDE
EQQMVKEEAFQQNGKQTATPGCEKVGLVKDTASPLSPKPLVTPTSPTVSVASGTPETPVT
PNSTSPSFIPKRKTARKQFPKRKLDGRSDEEREKEEEGKETEGGQESKRARIEGSPEKMG
IDEEAMEVEQNNRNTVEKELLKAKDQGNMNVTNAEKENKKQSDEKETEQEGEKYEVNGNN
KGMKKVTKEEKCSPERVMKKLKDVEEEKIEGSAKKKAINSFFAPRKAAMKLEKSEEKSNV
EKKDGEKPAAATTSEEKEKKCEKDVEPANQSQYDPSKAHYHPIDDACWRKRQRVPYLAVA
RTFEKIEEDSGRLRNIETLSNFLRSVILLSPDDLLCCVYLCLNQLGPAYQGLELGVGETV
LMKAVAQATGRQLDKIKTEAQEKGDLGLVAESSRSNQRMMFAPANLSAVGVFSKLKEIGN
MSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLAALSQAVCLSPPG
QEFPPAVIDAGKGMSADSRRAWLEEKGLILKQTYCEMPNYDVIIPVMLRLGIDELPNHCK
LTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHILESGEVRIFSRNQED
NTSKYPDIISRIPQIKKESVLSCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVDASEIKV
QVCVYAFDLLYLNGESLVREPLSKRRALLRKSFMEKEGEFVFARSLDSNNTETIAEFLEQ
SIRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLEGVGDTVDLCVIGAYLGKGKRAG
SYGGFLLGCYDEENEEFQAVCKIGTGFKDEDLEQHYNFLKEHILPKPRPYYRVDQSAEPD
VWLDAVQVWEVKCADLSLSPVYKAAMGLVDPDKGISLRFPRFLRIRDDKKPEDATTGAQI
ADLYRKQQQIQNQGEKDDLEDYY
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatatcgtccttctttcagccaatgaagtgtaaggagaaggatggcatg
cccaaagggaaatctgagtcagttaaaagccccctcaaacctcagaatattgatcaggaa
tgtgattcaccagtgaagacaagtaagcggaaccgagcaatcatagacagtgatgatgaa
gagcagcagatggtaaaagaagaggctttccagcaaaatggaaaacaaacagccacacca
ggctgtgagaaggttggccttgttaaggatacggccagtccactctcaccaaagcccctt
gttaccccgacaagtcctactgtttcggtagcttctggcactcctgaaacgcctgttacc
ccgaattccacttcaccctccttcattccaaaacgcaagactgcccgtaaacagtttccc
aagaggaaattggacggcaggagtgatgaagagcgagaaaaagaggaggaaggaaaagag
acagagggaggacaggagagtaaacgagcaagaatagaaggatctcctgaaaagatggga
attgatgaagaggctatggaggtggagcaaaataacagaaatactgtggagaaagaacta
ctgaaagcaaaggatcagggaaacatgaatgtgactaatgctgaaaaagagaataaaaaa
caaagtgatgaaaaggaaactgaacaggaaggagagaagtatgaagtgaatgggaacaat
aaaggaatgaaaaaggtaacgaaggaggaaaaatgcagtcctgaaagagtgatgaagaaa
ttgaaggatgtagaagaggagaagatagagggatctgctaagaaaaaagccatcaacagt
ttttttgcacccagaaaagctgcaatgaagctggaaaaatcagaagagaaaagtaatgta
gagaagaaggatggcgagaagcctgcggctgctactacttctgaggagaaagaaaagaag
tgtgagaaggatgtagaacctgcaaaccagagccaatatgatccttctaaagctcactac
catcccattgatgatgcttgctggaggaagaggcagagagttccatatctggctgttgcg
cgaacctttgagaagattgaggaagattcgggcaggttgagaaacattgagactctgtcc
aactttctgcgatctgttatcctactctctccagatgacctcttgtgctgtgtgtacctg
tgtctgaatcagcttggccccgcctaccaggggctagagctaggtgtaggggaaacagta
ctgatgaaagctgttgcccaggcgactgggcgtcaactggacaaaatcaagacagaggcc
caggaaaaaggtgacctgggattggtagcggagagttcccgtagcaaccagagaatgatg
tttgcaccagcgaatctgagtgcagtgggcgtgttcagcaaactgaaggagattggcaat
atgagcggaaactctgcaatgaataagaaaattgacatcattaagggtctgtttgtggct
tgtcgtttctctgaggccagatacattgtgaggtcactggcaggcaaactgaggattgga
ttggctgagcagagtgttttagcagctctgagtcaagcagtatgtctgagtccaccaggt
caagaattcccgccagctgtgattgatgcaggaaaggggatgagtgcagacagcaggaga
gcatggcttgaggaaaaaggactcatccttaagcagacttactgtgaaatgccaaattat
gatgtcatcatccctgtcatgttgaggttgggcatagatgaactgcctaatcactgcaaa
cttactccaggtgtgccactgcgccccatgctggcccacccaactaagggagtaggggag
gtgatgaaaaggtttgatgaggctgctttcacctgcgaatacaagtatgatggagagaga
gcacagattcacattcttgagagtggtgaggttcgtatcttcagccgaaaccaagaggac
aacaccagcaaataccctgacatcatttcacggatcccacagataaagaaggaatctgtg
cttagctgtgtgttggactcagaggcggttgcatgggacagagagaaaaagcagattcag
ccctttcaagttcttaccacacgcaaaaggaaggatgtggatgcatctgagattaaggtg
caggtttgtgtgtatgccttcgacctgctgtacttaaatggagagtctctagtacgggag
ccattgagcaagcgtcgagctttgttaaggaagagtttcatggagaaggagggagagttt
gtcttcgctcgttctctcgactctaataacactgaaactatagcagagttcctggagcag
tccatacgagactcttgcgaaggcttgatggtgaagaccctggagaaagatgccacttac
gaaattgccaaacgctctcataactggcttaagctgaagaaggactatttggaaggtgtg
ggggatacagtggatctgtgtgtgattggtgcatatctagggaagggcaagagagccggt
agctatgggggtttcctgcttggttgctatgatgaagagaatgaggagtttcaggctgtc
tgtaagataggaacaggcttcaaagatgaagatctggagcagcattacaatttcttaaag
gaacacatccttcctaagccccgcccctactacagagtggatcaatctgcagagccagat
gtttggctggatgctgtacaagtgtgggaagtgaaatgtgctgatctgtcactgtctccg
gtgtacaaagcagcaatgggattggtggacccagacaaagggatttcccttcgctttcct
cgattccttcgcatcagagatgacaagaaaccagaggatgctactacaggagcgcagatt
gctgatctctacagaaagcagcagcagattcagaatcaaggagaaaaggatgatctagag
gattactactga

DBGET integrated database retrieval system