KEGG   Paramormyrops kingsleyae: 111833143Help
Entry
111833143         CDS       T05788                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki03030  DNA replication
pki03410  Base excision repair
pki03420  Nucleotide excision repair
pki03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pki00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111833143 (lig1)
   03410 Base excision repair
    111833143 (lig1)
   03420 Nucleotide excision repair
    111833143 (lig1)
   03430 Mismatch repair
    111833143 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pki03032]
    111833143 (lig1)
   03400 DNA repair and recombination proteins [BR:pki03400]
    111833143 (lig1)
Enzymes [BR:pki01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111833143 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     111833143 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111833143 (lig1)
DNA replication proteins [BR:pki03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111833143 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111833143 (lig1)
DNA repair and recombination proteins [BR:pki03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111833143 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     111833143 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     111833143 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 111833143
NCBI-ProteinID: XP_023646868
Ensembl: ENSPKIG00000016081
LinkDB All DBs
Position
Unknown
AA seq 972 aa AA seqDB search
MQRSIASFFQPMKGKEKEGNKSDGVAKNKTEPVKSPLKTQNGVAECDSPVKKVSKRSRRI
RDSDEEGEAGTKEDAISPAPLPTPEKGAVVKAASTVSSPAAADTPSTPSAPASAAAAVTP
ASSISPGTPSSISPSGILKRKTARKQFPKRKLATDVFGEEDHGPDEQEVKRSRTEGPPGT
GEPEEMEVDNKTTEESKEPEGERVTVKEEEEEEGEPEGERATVKGEDAEAKGEKELGARS
PEQVKATERSEKQEAKEGGKTPSAKKATISSFFTPRKAAAKLQKAEDAGKERSDKQMGAA
EPATGGGESEEAKPLSQTDYNPSRTGYHPVQHACWSRGQRVPYLAVARTFEKIEEEQGRL
RNIETLSNLLRSVLVLSPDDLLCCIYLCLNQLGPAYLGMELGVGETVLMKAVAQATGRQL
DKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAAGVFSRLKDIAKMSGNSSMNKKTEI
IKGLFVACRHSEARYIVRSLAGKLRIGLAEQSVLAALAQAVCLTPPGQEFPPPIVDAGKA
MTPENRRAWIEEKALIVKQTYCEMPNYDAIIPVLLKEGIDELPKHCKLTPGVPLRPMLAH
PTKGVSEVMKKFDEAAFTCEYKYDGERAQIHILENGEVHVFSRNQEDNTSKYPDIIARVP
QVKKASVRSCILDSEAVAWDREKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDLLYLN
GESLVRQPLSRRRALLKESFEEREGEFVFARALDCDNTDAIAEFLELSVRDSCEGLMVKT
LEKDATYEIAKRSHNWLKLKKDYLDGVGDTVDLCVIGAYVGKGKRAGSYGGFLLACYDED
NEEFQSVCKIGTGFKDEDLQQHFNFLKEHVLPKPRPYYRVDQSAEPDLWLDAVQVWEVKC
ADLSLSPVHKAAMGLVDPDKGISLRFPRFLRIRDDKKPEDSTTGCRLAVFTRAPPKNSHA
SRLGLGGGTSTG
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatagcgtctttctttcagccgatgaaagggaaggagaaggaggggaat
aaaagcgacggagtagccaaaaataagactgaaccagtcaagtcacccctgaagactcag
aacggagtggcagaatgtgattcgcccgtgaagaaggtcagcaagcgcagccggcgaatc
agagacagcgacgaggagggagaggcgggcactaaggaggacgcgatctcgccggccccc
ctgcccacccccgaaaagggggcagtagtcaaggcagcttccacggtctcctcgccggct
gctgcagatactccatctacaccgagtgccccagcttccgcagctgcggcagtcaccccg
gcctcctccatttctccaggaactccctcctccatttctccctctgggatcctcaaacgg
aagaccgcgaggaagcagtttcctaagcggaagctggcgactgatgttttcggtgaggag
gaccatggtccagatgaacaggaggtgaagaggtcgcgcacagagggacccccaggcact
ggagaaccagaagagatggaagttgataataagactacagaagaaagcaaggagccggaa
ggagagagggtcactgtgaaggaggaggaggaggaggaaggggagccggaaggagagagg
gccactgtgaagggggaggatgcggaggccaagggagaaaaggagctgggggcgaggagt
ccggagcaggtgaaggccacagagaggtcggagaagcaggaggcgaaggagggaggcaag
acgccgtcggccaagaaggcgactatcagcagcttcttcacgcccaggaaggcagcggcg
aagctgcagaaggccgaggatgctgggaaggaacggtcagacaagcagatgggcgcggcc
gagccggcaacaggagggggcgagagtgaggaggccaagcctctcagccagaccgactac
aacccgtccaggaccggctatcaccccgtgcagcatgcctgctggagccggggtcagagg
gtgccgtacctggccgtggcccgtacctttgagaagatagaggaggaacagggcaggctg
aggaacatcgagaccctgtcaaaccttctccgctctgtgctggttctctctccagacgac
ctgctctgctgcatctacctctgtctcaaccagctgggccctgcctacctggggatggag
ctgggagtcggggagacggtcctgatgaaggctgttgcccaggcaaccgggcgacagttg
gacaaaatcaaggcagaggcgcaggagaaaggggacctgggattggtggcggagagctcc
cggagcaaccagagaatgatgtttgccccggccaatctgacagcggcgggcgtgttcagc
cggctcaaggacatcgccaagatgagcggcaactcctctatgaataagaagactgagata
atcaaaggtctgtttgtggcttgtaggcactctgaggcaagatacattgtgaggtctttg
gcgggaaagctgcggatcgggctggcggagcagagcgtgctggcggctctggcccaagcc
gtgtgtctgactcctccgggccaagaattcccacccccgatagtcgatgccgggaaggcg
atgactcccgagaacagacgggcctggattgaagagaaggctcttatcgtcaagcagacg
tactgtgagatgcccaactatgacgccatcatcccagtgctgctgaaggaggggattgac
gagctgcccaaacactgcaagctcacgccaggagttcctctacgacccatgttggcccac
ccaacaaagggcgtgtcagaggtgatgaagaaattcgacgaggccgccttcacgtgcgaa
tacaagtacgacggggagagagcgcagatccacatcctggagaacggggaggtccacgtc
ttcagccgtaaccaagaggacaacaccagcaaatatccggacatcatcgcccgagtgccc
caggtgaagaaggcctcagtgaggtcctgcatcctggactccgaggcagtggcctgggac
agggaaaaaaaacagatccagcccttccaggttctcaccactcggaagagaaaggacgtg
gacgcttcagagattaaagtgcaggtttgcgtttacgccttcgacctgctctacctaaac
ggggagtccctggtgaggcagcctctatcgaggcggcgggccctgctgaaggagagcttc
gaggagcgtgaaggagagtttgtgttcgcccgcgcactcgactgcgacaacacggacgcc
atcgcggagttcctcgagctgtccgtgcgagattcgtgcgagggcctcatggtgaagacc
ctggagaaagacgccacctatgaaatagccaagcgctcgcacaactggctgaagctgaag
aaggactacctggacggcgtgggggacacggtggatctttgcgtcatcggtgcctacgtc
gggaaaggcaagcgggccggttcctacggaggcttcctgctcgcctgctacgacgaggac
aacgaggagttccagtctgtgtgcaagattggaacgggctttaaagatgaggacctccag
cagcatttcaactttcttaaggaacacgttcttccaaagcccaggccatactaccgcgtc
gaccaatcagcagagcccgacctgtggctggatgcggtgcaggtgtgggaagtgaagtgt
gcggacctgtccctgtctcccgtccacaaggctgccatgggattggtggatccagacaag
gggatctccctgcgctttcctcgcttcctcagaatccgggatgataaaaagccagaagat
tccaccaccggatgtcgactggcagtgttcacccgagcaccccccaagaacagtcacgcc
tcccgcctgggcctgggcggtggtacaagcacagggtga

DBGET integrated database retrieval system