Paramormyrops kingsleyae: 111849339 Help Entry 111849339         CDS       T05788                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism pki  Paramormyrops kingsleyae Pathway pki04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pki00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111849339  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pki04121]     111849339    03400 DNA repair and recombination proteins [BR:pki03400]     111849339 Ubiquitin system [BR:pki04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      111849339    Cul5 complex      111849339 DNA repair and recombination proteins [BR:pki03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      111849339 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  111849339 NCBI-ProteinID:  XP_023677902 Ensembl:  ENSPKIG00000016997 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQKLFKDDQVLDDNKTLGDC GFTNQTARPQAPATIGLAFRIGDDMFEQLRVDPFSSPPELPDVMKPQDSSSAANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttgatgatccggcgtcataagacgaccattttcactgacgccaaggag tccaccactgtatatgagctaaaacgtatcgtagaggggattctcaagagggcgcctgag gagcagaaactcttcaaggatgaccaggtgctagatgacaacaagaccctgggagattgc ggcttcaccaaccagactgctaggccccaagccccagccactattggactggctttccgt atcggcgatgacatgttcgaacagcttcgcgtggaccccttctccagcccccccgagctg ccagatgtgatgaagccacaagactccagcagcgctgccaatgagcaggccgtgcagtga

DBGET integrated database retrieval system