KEGG   Paramormyrops kingsleyae: 111852932
Entry
111852932         CDS       T05788                                 

Definition
(RefSeq) erythropoietin-like isoform X1
  KO
K05437  erythropoietin
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111852932
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pki04052]
    111852932
Cytokines and growth factors [BR:pki04052]
 Cytokines
  CSF and other factors
   111852932
SSDB
Motif
Pfam: EPO_TPO DUF2205
Other DBs
NCBI-GeneID: 111852932
NCBI-ProteinID: XP_023685093
Ensembl: ENSPKIG00000019880
LinkDB
Position
Unknown
AA seq 181 aa
MRITTWGLVTVLLMVLDWTRPGSPSALRPICDPLVLDRFIQESRDIELAMGTCRDRCRLS
ESLTVPRTSVDFAAWERKDVREQTQEVQEGLRLLGQAIERVKASVSDTALIGLLDSSYDN
IHSIKQVIRSLDMQDWSPSSRTWDTWTVSSMPELFRVHTNFLRGKVHLLLSRAPACRQEN
H
NT seq 546 nt   +upstreamnt  +downstreamnt
atgcggattacgacatggggacttgtcaccgtgctgctaatggtgctggactggacccgg
ccaggatcgccctctgcattgaggcccatctgtgacccacttgtcctggaccgcttcatc
caggagtcccgtgacattgagcttgctatggggacgtgccgggacaggtgccgcttgtcc
gagtcgcttactgttccgcggaccagcgtcgacttcgccgcctgggaaaggaaagacgtc
cgggagcaaacccaggaggtccaggaaggactgcggctattggggcaagcgatcgagagg
gtgaaggcatccgtctctgacaccgctctcattggcctcctggacagcagctacgacaac
attcatagcatcaaacaggtgatccgcagtctcgacatgcaggactggtccccctcttcc
agaacgtgggacacttggaccgtgtcctccatgccagaactcttccgtgtccacaccaac
ttcctgcgaggcaaagtgcacctccttctgagccgtgcgccagcttgccgtcaagaaaat
cactga

DBGET integrated database retrieval system