KEGG   Pleomorphomonas sp. SM30: OHA_1_00587
Entry
OHA_1_00587       CDS       T05766                                 

Gene name
pbpF_1
Definition
(GenBank) penicillin-binding protein 1F
  KO
K05367  penicillin-binding protein 1C [EC:2.4.1.129]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_00587 (pbpF_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pleo01003]
    OHA_1_00587 (pbpF_1)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_00587 (pbpF_1)
Enzymes [BR:pleo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     OHA_1_00587 (pbpF_1)
Glycosyltransferases [BR:pleo01003]
 Polysaccharide
  Bacterial polysaccharide
   OHA_1_00587 (pbpF_1)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   OHA_1_00587 (pbpF_1)
SSDB
Motif
Pfam: Transgly BiPBP_C Transpeptidase
Other DBs
NCBI-ProteinID: BBE71017
LinkDB
Position
1:626575..628785
AA seq 736 aa
MIGAWRVWPGWRGRADTPELGSAATRPLAVIAGRRYARGRSHRSGSRPLSRRAALLPALI
VAVGLAATAAPLLLRNAVDAAVPADLRVATSRLVVDRDERLLRAFQVEDGLWRLPVTRAD
VDPLYVAMLQASEDRRFAEHRGVDATALVRAAFQLATSGRIVSGGSTLTMQVVRLAERRH
TRTVGGKFGQIVGALALERYAGKDDILDAYLRLAPFGGNVEGVRSAALAYLGKEPRRLTP
AEAALLVALPQAPEARRPDRHPERARIARDRVLDRAAAAGVISVADAEAAKREPVPKIRR
AFPMLAPQTADRVVRETPAVGTIRLTLEAGLQGALEHLASERAKAIGPDVSVAILVADVA
SGEVLASVGSAGLFEERRDGFVDMTRAVRSPGSTLKPFIYGLAFEAGLAHPQTLVEDRPT
AFAGYTPRNFDKTFQGTVTIRTALEMSLNVPAVQVLEAVGPARLVSRFRRAGVVPKLPDL
APAGLAVGLGGVGLTLHDLVTLYTALARGGHPLPLAERHGAIRPAKPAKPLMDERAAAYV
TDILAGTPGAARGDRRLALKTGTSYGYRDAWAVGYDGRRVIGVWVGRPDGAPMPGLMGVD
VAVPILGDAFVRAGGVGPLPPAPDGLLVASSADLPPPLRRLRGSRPAVVERDTGPAIAYP
PNGARVDLAAGGGGRMPLALKLRNGRGPYTWFADGAPIGREPFAREFRYVPAGSGFVTLS
VIDAEGRADRVTVFVE
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgatcggcgcttggcgcgtttggccagggtggcgtggacgtgcggacacccccgaactc
ggctccgccgccacccgccccctcgccgtcatcgccgggcgccgctatgctcgtggccgg
tcccatcgctccggctctcgtcccttgtcccgccgcgccgccctccttcccgccctgatc
gtcgccgtcggcctcgccgcgaccgcggccccgctgttgctgcgaaacgccgtcgacgcg
gcggtgcccgccgatctccgggttgcgacgtcgcggctggtggtggaccgcgacgagcgg
ctgctgcgcgccttccaggtcgaggacgggctgtggcggctgccggtgacgcgggcggac
gtcgatccgctctacgtcgcgatgctccaggcctccgaggaccgccgctttgccgagcac
cgcggcgtcgacgcgaccgcgctggtgcgggcagcgttccagttggcgacgtcggggcgg
atcgtctccgggggctcgaccctgacgatgcaggtggtccgccttgccgaacgccgccac
acccggacggtcggcggcaagttcgggcagatcgtcggggcgctggcgctggagcgttat
gccggcaaggacgacatcctcgacgcctatctccgcctcgctcccttcggcggcaacgtc
gagggcgtgcgctccgccgcgctcgcctatctcggcaaggagccgcgccggctgaccccg
gcggaggccgcgctgctggtggcgctgccgcaggcgcccgaggcgcgccggcccgaccgc
catcccgagcgcgcccgtatcgcccgcgaccgcgtgctcgaccgcgccgcggccgccggc
gtgatctcggtggcggacgccgaggccgccaagcgcgagccggtgccgaagatccgccgc
gccttcccgatgctggcgccgcagaccgccgaccgggtcgtgcgcgagacgcctgccgtc
ggcacgatccgcctcaccctggaggccggcctccagggcgcgctcgagcatctcgcctcc
gagcgcgccaaggcgatcggcccggacgtctcggtggcgatcctggtcgccgacgtcgcg
agcggcgaggtgctggcctcggtcggctcggcggggctgttcgaggaacggcgcgacggc
ttcgtcgacatgacccgcgcggtgcgctcgccgggatcgacgctgaagcccttcatctac
gggctcgccttcgaggccggcctagcccatccgcagacgctggtcgaggatcggcccacc
gccttcgccgggtacacgcccaggaacttcgacaagaccttccagggcacggtgacgatc
cgcacggcgctggagatgtccctgaacgtgccggcggtgcaggtgctggaggcggtcggg
ccggcgcggctggtgtcgcgcttccgtcgcgccggggtggtgccgaagctgccggacctc
gccccagccggcctcgccgtcggcctcggcggcgtcgggctgacgctgcacgacctcgtg
acgctctataccgcgctcgcccgtggcggccatccgctgccgctcgccgagcgccacggc
gcgatccggccggccaagcccgccaagccgctgatggacgagcgcgcggccgcctacgtc
accgacatcctcgccggcacgccgggcgccgcccgcggcgaccgccggctggcgctgaag
accggcacctcctacggctatcgcgacgcctgggcggtcggttacgacggccgccgcgtc
atcggcgtctgggtcggccggccggacggcgcgccgatgccggggctgatgggcgtcgac
gtcgcggtgccgatcctcggcgacgccttcgtgcgcgccggcggcgtcggcccgctgccg
ccggcgccggacggtctgctggtcgcctcgtcggccgatctgccgccgccgctccgccgc
ctgcgcggctcgcggcccgcggtggtggagcgcgacaccgggccggcgatcgcctatccg
cccaacggcgcgcgggtcgacctcgccgccggcggcggcgggcggatgccgctggcgctg
aagctgcgcaacggccgcggcccctacacttggttcgccgacggcgcgccgatcggccgt
gagcctttcgcccgcgagttccgctacgtgcccgccggcagcggcttcgtgacgttgagc
gtgatcgacgccgagggcagggcggaccgcgtcaccgtctttgtggagtaa

DBGET integrated database retrieval system