KEGG   Paucimonas lemoignei: NCTC10937_02571Help
Entry
NCTC10937_02571   CDS       T05492                                 

Gene name
ahpF
Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
plg  Paucimonas lemoignei
Brite
KEGG Orthology (KO) [BR:plg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC10937_02571 (ahpF)
Enzymes [BR:plg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC10937_02571 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 Thi4 Glutaredoxin K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: SQF98442
UniProt: A0A2X4CXV4
LinkDB All DBs
Position
1:2883623..2885185
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDITLNDSGTDAR
TPSFSLNSPGQDISLRFAGIPMGHEFTSLVLALLQVGGYPSKASADTVEQVRSLQGDFTF
ETYFSQSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQAEVTDRQIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNSKEAFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRAEQLIPGKDGAL
HEVKFAGGASLKTKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLTSLPNVTVITNAQTTEVTGDEQ
KVNGLRYKNRLNNEEVTVDLEGIFVQIGLLPNTDWLKGTIELSPRGEIVVDSRGETSIPG
IFAAGDVTTTPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaagtcgtatctggaacgggtcacccgccca
atcgagatcgtcgcgtcccttgatgacggcgcgaaatcccaggaaatgctggcgttgctc
aatgacgtgatcagcgtttcgaaagacatcaccctcaatgacagcggcaccgatgcgcgt
acgccatcgttctcgctcaacagcccgggacaagacatcagcctgcgattcgccggtatc
ccgatgggccatgaattcacctcactggtgctggcgctgctgcaagtgggcggctacccg
tccaaagccagtgcggacaccgttgaacaagtccgctctctgcagggcgacttcacgttc
gaaacctacttctctcagtcgtgccagaactgcccggatgttgtccaggcgttgaacctg
atggccgtactgaaccctaacatcaagcacgtcgccatcgacggtgcgctcttccaggcg
gaagtcacggatcgccagatcatgtcggtgcccagcatctacctgaacggcgagctgttt
ggtcaaggtcgtatgggcctggaagaaatcctcgccaagatcgacaccggtgccggtgct
cgtcaggccgaaaaactcaatagtaaagaggcgttcgacgttctggtggttggcggtgga
ccagccggttcagctgctgctgtttatgcagcacgtaaaggcattcgtactggcgtcgcg
gctgaacgcttcggcggtcaggtgctggacaccatggccatcgaaaacttcatttccgtg
cagcacaccgaaggcccgaaactcgcggtcgccctcgaagagcacgtcaagcagtacgaa
gtggacatcatgaacctgcagcgcgccgagcagctgatcccgggcaaagatggcgcgctg
catgaagtgaagttcgcaggcggcgccagcctgaagaccaaaactgtcatcctggccacc
ggtgcgcgctggagggaaatgaatgtccctggcgagcagcaataccgcaacaagggcgtg
gcgtattgcccgcactgcgacggtccgctgttcaaaggcaaacgtgtggccgtcatcggt
ggcggtaactcgggggttgaagccgcaatcgacctggcgggtatcgtgtcccacgtgacg
ctgcttgagtttgacgtgcaactgcgcgccgatgcggtgctgcagcgcaagctgaccagc
ctgccaaacgtgaccgtgatcaccaatgcccagaccaccgaagtcacgggtgatgagcag
aaggtcaacggcctgcgttacaagaaccgtctgaacaacgaagaagtcactgtcgacctg
gaaggcatcttcgttcagatcggcttgctgcccaacaccgactggctcaagggcaccatc
gagctgtcgcctcgtggcgaaatcgtcgtggactcccgtggcgaaacgtccatccctggc
atctttgcagcgggtgacgtgaccaccacaccgtacaagcagatcatcattgctctgggg
gagggcgcaaaagcctctctgagcgcattcgatcacttgattcgcacgtccgcgccagcc
tga

DBGET integrated database retrieval system