KEGG   Planococcus versutus: I858_009705Help
Entry
I858_009705       CDS       T04421                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
pll  Planococcus versutus
Brite
KEGG Orthology (KO) [BR:pll00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pll02022]
    I858_009705
Two-component system [BR:pll02022]
 OmpR family
  Unclassified
   I858_009705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg GerE
Motif
Other DBs
NCBI-ProteinID: ANU27261
UniProt: A0A1B1S248
LinkDB All DBs
Position
complement(2870040..2870720)
Genome map
AA seq 226 aa AA seqDB search
MKILVVEDNPSVSSMLELFFSKEGITGDFAADGLEGYRKYKAGEYDLLILDWMLPGMDGI
ALCRKIREEGSSVPIIMLTAKDSESDQVIGFEMGADDYVTKPFSPLTLMARIKAVTRRTQ
KIEPVSDLIQTVYFTVNKETRDILKDGQEVDSLTPKEFDLLVFFLQHPKQVFSREQLLEQ
VWGYQFYGDERTVDVHIKRLRKKINDGDKLFHTVWGVGYKFEEHAD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattggtagtagaagacaatccaagtgtcagttcgatgctagaactgtttttt
tcaaaagaagggattaccggagactttgcagcagatgggttagaaggttaccggaaatac
aaagcaggcgaatacgatttgctcattttagactggatgcttccggggatggatggcatt
gcgctgtgtcgaaaaattcgagaagaaggaagttctgtcccaatcattatgctgactgca
aaagatagtgaatccgatcaagtcattggatttgaaatgggggcagatgactatgtgaca
aaaccatttagtccattaaccttaatggcgcgtattaaagctgtcacacgtcgcacacag
aaaatagaaccagtgtccgatttgattcaaaccgtttattttacagtcaataaagaaaca
cgtgatattttaaaagatggtcaagaagtggatagcctgacacctaaagaatttgattta
ctagtattttttctgcaacatccaaagcaagtgttcagccgcgaacaattattagaacaa
gtttggggttatcagttttatggggatgaacgaacggttgatgttcacataaaacgcttg
cgtaaaaaaataaatgacggggacaagctgttccatacagtatggggagttggctataaa
tttgaagaacacgcggattaa

DBGET integrated database retrieval system