Prochlorococcus marinus MIT 9303: P9303_05071 Help Entry P9303_05071       CDS       T00466                                  Symbol secG Name (GenBank) conserved hypothetical protein   KO K03075   preprotein translocase subunit SecG Organism pmf  Prochlorococcus marinus MIT 9303 Pathway pmf02024   Quorum sensing pmf03060   Protein export pmf03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pmf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     P9303_05071 (secG)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     P9303_05071 (secG)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     P9303_05071 (secG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pmf02044]     P9303_05071 (secG) Secretion system [BR:pmf02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    P9303_05071 (secG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecG Motif Other DBs NCBI-ProteinID:  ABM77259 UniProt:  A2C6Z9 LinkDB All DBs Position complement(499213..499443) Genome browser AA seq 76 aa AA seqDB search MITSVLSWVWVASGVLLMLLVLLHSPKGGGMGGISASGSSSFTSTSSAEATLDRITWTCL AIFLTLAVILSAGWLT NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgattacctctgttctctcctgggtctgggtcgcttctggcgttctcttgatgctgttg gtcctgttgcatagccccaagggtggtggcatgggagggatatccgctagcggcagctcc agtttcacaagcaccagcagtgccgaggcaaccttggacaggatcacctggacatgccta gccatattcttgactcttgcagtgatccttagcgctggctggctcacttga

DBGET integrated database retrieval system