KEGG   Prochlorococcus marinus MIT 9301: P9301_04241
Entry
P9301_04241       CDS       T00488                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00010  Glycolysis / Gluconeogenesis
pmg00020  Citrate cycle (TCA cycle)
pmg00620  Pyruvate metabolism
pmg01100  Metabolic pathways
pmg01110  Biosynthesis of secondary metabolites
pmg01120  Microbial metabolism in diverse environments
pmg01200  Carbon metabolism
Module
pmg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9301_04241 (pdhC)
   00020 Citrate cycle (TCA cycle)
    P9301_04241 (pdhC)
   00620 Pyruvate metabolism
    P9301_04241 (pdhC)
Enzymes [BR:pmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P9301_04241 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL DUF406
Other DBs
NCBI-ProteinID: ABO17047
CYORF: P9301_04241
UniProt: A3PBC2
LinkDB
Position
369312..370679
AA seq 455 aa
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENEDEIASVQEQNKGNQPEVSSSDQLELVSNKTEEKPVVQSEI
VEKQEKEVVLMNEKAASSFNSDQINAATSNVSSRVIASPRAKKLASQMGVDLAKVHGSGP
HGRIQADDILKANGQPVSIPWIGEGGSPASIPGANLGVESKPETSGNSFGNPGEIVQFNT
LQKAVNKNMESSLDVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRSKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANSDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLASLIEDEPETLVS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtctcacgaaatattcatgcctgccttgagttctactatgacggagggcaagattgtg
gaatggttgaaaaatccaggagataaagttgaaagaggtgaatctgtcttggttgttgaa
tctgacaaggcagatatggatgttgaatcttttcaagatggatatcttgcggctgtttta
atgcctgctggcagcactgcaccagtgggagagactattggccttatcgtagaaaatgag
gatgagatagcttctgttcaagaacaaaataaaggaaatcaacccgaagtttctagttcg
gatcaacttgaattggtaagcaataaaactgaagaaaaacctgtagttcaaagtgaaatt
gttgaaaaacaagaaaaagaagtcgtattaatgaatgaaaaggcagcatcatcttttaac
agtgatcaaataaatgctgctacgagtaatgtttcttcgagggtgattgcatctccaaga
gctaaaaaacttgcctctcaaatgggtgttgatttagcaaaggttcatggatccggacct
cacggaaggattcaagccgatgatattttaaaagctaatggccaaccagtctctatacca
tggataggtgaaggtggttctcctgcaagtatacctggtgcaaatttgggagttgaaagt
aaaccagaaacttcaggaaatagttttggtaatcccggagaaatagttcaatttaatact
cttcaaaaagcggtaaataaaaatatggaatctagtttagatgtgccatgttttagggtg
ggttattccattaacacagataaattagataatttctacaaaaaagtaaaacagaacgga
gttactatgactgctttactagtaaaggcagttgcaaagacactaaagaaacatcctcaa
gttaactcaagtttttcagagaatggaatttcttatccagaaaatataaatattgctgtt
gctgttgcgatggaagatggtggactaataactccagttttaaaagaaccatgcaatact
gatttatttgaattgtctagggaatggaaagatctcgtaaaaagatcaagatcaaaacaa
ttagaacctgatgagtactctacgggaaccttcactttatctaaccttgggatgtttgga
gttgatagatttgacgcaattcttcctccaggtaccggtgcaattttagccatagcttca
tcgaaaccaaccgttgttgctaatagtgatggttcaatatctgttaaaaaaataatgcaa
gtaaatctaacagctgatcatagagtgatctatggagctgatggagcttcattcttaaaa
gacttggcttccctaattgaagatgagccagagactcttgtctcctaa

DBGET integrated database retrieval system