KEGG   Pseudomonas mendocina NK-01: MDS_3648Help
Entry
MDS_3648          CDS       T01473                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Brite
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MDS_3648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEB59679
UniProt: F4DTB3
LinkDB All DBs
Position
4013251..4013832
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHISAETLEFHHDKHHNTYVVNLNNLVPGTEFEGKSLEEIVKTS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFSKVSIGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAQNYAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccgccgctgccttacgaaaagaatgctctcgagccgcacatttcc
gccgagaccctcgaattccaccacgacaagcaccacaacacttacgtcgtgaacctgaac
aacctggtgccgggcactgagttcgaaggcaagagcctggaagagatcgtcaagacctcc
tcgggcggcatcttcaacaacgccgctcaggtgtggaaccacaccttctactggaactgc
ctgtcgccgaacggcggtggccagcccactggcgccctggctgacgccatcaacgctgcc
ttcggttccttcgacaagttcaaggaagagttcagcaaggtctccatcggcaccttcggt
tccggctggggctggctggtgaagaaggctgacggttccctggccctggccagcaccatc
ggcgccggctgcccgctgaccagcggcgacactccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtagaggcgttctggaac
ctggtcaactgggacttcgtcgctcagaactacgcggcctga

DBGET integrated database retrieval system