KEGG   Prochlorococcus marinus MIT 9313: PMT_0220Help
Entry
PMT_0220          CDS       T00143                                 

Definition
(GenBank) Dihydrolipoamide S-acetyltransferase component (E2), pyruvate de
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
pmt00010  Glycolysis / Gluconeogenesis
pmt00020  Citrate cycle (TCA cycle)
pmt00620  Pyruvate metabolism
pmt01100  Metabolic pathways
pmt01110  Biosynthesis of secondary metabolites
pmt01120  Microbial metabolism in diverse environments
pmt01130  Biosynthesis of antibiotics
pmt01200  Carbon metabolism
Module
pmt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT_0220
   00020 Citrate cycle (TCA cycle)
    PMT_0220
   00620 Pyruvate metabolism
    PMT_0220
Enzymes [BR:pmt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PMT_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF711
Motif
Other DBs
NCBI-ProteinID: CAE20395
CyanoBase: PMT0220
CYORF: PMT0220
UniProt: Q7V8V4
LinkDB All DBs
Position
250807..252126
Genome map
AA seq 439 aa AA seqDB search
MPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAVLMPAGCS
APVGETIGLIVESEAEIAAVQANAPAAPASDPAPLKTAAKVVDDPAPASTPAPVVESPPV
AAPPPVASQAVDTDKRIVASPRAKKLAAQMGVDLAKLRGSGPHGRIQAEDVQLAAGQPIS
VPQLAEGNASFATTHATSAGVAHAVSSPVGQSFGAPGETAAFNNLQQAVNRNMEASLAFP
CFRVGYTITTDQLDAFYKQVKPKGVTMTALLAKAVALTLVRHPQVNAAYSTAGMVYPEQV
NVAVAVAMDDGGLITPVLQNADRTDLYEMSRQWADLVKRSRSKQLQPEEYSTGTFTLSNL
GMFGVDRFDAILPPGTGAILAVAASRPAVVAGKDGSIAVKRQMQVNLTADHRVIYGADGA
AFLKDLAELIETRVESLAL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctctgagctcaacgatgacggagggcaagatcgttgagtggcttaagcaacct
ggcgacaaggttgggcgtggtgagtcggtgcttgtggtggagtcagataaagcggatatg
gatgtggagtcatttcaagatggctacttggccgcggtcttgatgcctgctggttgttcg
gctccagtgggcgaaacgattggtttgatcgttgaaagtgaggccgaaatcgcggctgtt
caggccaatgcccctgctgcgccagcgtctgatcctgcccctctcaagactgctgcaaaa
gttgtcgatgaccctgccccagcatctactccagcgcccgtcgtggagagtccccccgtt
gctgctccgccgcctgttgccagccaagcagtagacactgacaaacgcatcgttgcttca
ccgcgggctaaaaaacttgctgcgcagatgggtgttgatctggccaagttgaggggtagc
ggaccccatggccgtatccaggctgaagacgtgcagctggctgcaggtcagccgatcagt
gtgcctcagcttgctgaaggaaacgcttctttcgcaacgacgcatgcaacttctgcaggc
gttgctcatgcagtgtcatctcctgtaggtcagagctttggggccccgggagaaaccgca
gccttcaacaacctccaacaagcggtcaaccgcaatatggaggccagtttggccttcccc
tgcttcagggttggctacacgatcacgactgatcagttggatgctttttacaagcaggtg
aagcctaagggcgtcacgatgacagcccttctggccaaagccgtggccttgacgctagtg
cgtcatccccaggtgaatgctgcttacagcaccgctgggatggtgtatccagagcaggtg
aatgttgctgttgcagtggcgatggacgatggcggtctgattacaccggttttgcagaat
gctgatcgcaccgatctctatgagatgtcgcggcagtgggcagatcttgtgaagcggtca
cgcagcaagcagttgcaacccgaggaatacagcactggtactttcaccctttccaatctg
ggcatgtttggcgtggaccgctttgatgcaatcttgccccctggcactggcgcaattttg
gcggtagctgcatcgcggcctgctgtggtggctggaaaggatggctcgattgcggtcaag
cgccagatgcaggtgaacctcactgccgaccatcgcgtgatttatggcgccgatggggcc
gccttcctcaaggatctggcagagctgattgagacgcgggtagagagtttggcgctctaa

DBGET integrated database retrieval system