KEGG   Prochlorococcus marinus MIT 9313: PMT_0220
Entry
PMT_0220          CDS       T00143                                 

Definition
(GenBank) Dihydrolipoamide S-acetyltransferase component (E2), pyruvate de
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
pmt00010  Glycolysis / Gluconeogenesis
pmt00020  Citrate cycle (TCA cycle)
pmt00620  Pyruvate metabolism
pmt01100  Metabolic pathways
pmt01110  Biosynthesis of secondary metabolites
pmt01120  Microbial metabolism in diverse environments
pmt01200  Carbon metabolism
Module
pmt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT_0220
   00020 Citrate cycle (TCA cycle)
    PMT_0220
   00620 Pyruvate metabolism
    PMT_0220
Enzymes [BR:pmt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PMT_0220
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF711
Other DBs
NCBI-ProteinID: CAE20395
CyanoBase: PMT0220
CYORF: PMT0220
UniProt: Q7V8V4
LinkDB
Position
250807..252126
AA seq 439 aa
MPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAVLMPAGCS
APVGETIGLIVESEAEIAAVQANAPAAPASDPAPLKTAAKVVDDPAPASTPAPVVESPPV
AAPPPVASQAVDTDKRIVASPRAKKLAAQMGVDLAKLRGSGPHGRIQAEDVQLAAGQPIS
VPQLAEGNASFATTHATSAGVAHAVSSPVGQSFGAPGETAAFNNLQQAVNRNMEASLAFP
CFRVGYTITTDQLDAFYKQVKPKGVTMTALLAKAVALTLVRHPQVNAAYSTAGMVYPEQV
NVAVAVAMDDGGLITPVLQNADRTDLYEMSRQWADLVKRSRSKQLQPEEYSTGTFTLSNL
GMFGVDRFDAILPPGTGAILAVAASRPAVVAGKDGSIAVKRQMQVNLTADHRVIYGADGA
AFLKDLAELIETRVESLAL
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcctgctctgagctcaacgatgacggagggcaagatcgttgagtggcttaagcaacct
ggcgacaaggttgggcgtggtgagtcggtgcttgtggtggagtcagataaagcggatatg
gatgtggagtcatttcaagatggctacttggccgcggtcttgatgcctgctggttgttcg
gctccagtgggcgaaacgattggtttgatcgttgaaagtgaggccgaaatcgcggctgtt
caggccaatgcccctgctgcgccagcgtctgatcctgcccctctcaagactgctgcaaaa
gttgtcgatgaccctgccccagcatctactccagcgcccgtcgtggagagtccccccgtt
gctgctccgccgcctgttgccagccaagcagtagacactgacaaacgcatcgttgcttca
ccgcgggctaaaaaacttgctgcgcagatgggtgttgatctggccaagttgaggggtagc
ggaccccatggccgtatccaggctgaagacgtgcagctggctgcaggtcagccgatcagt
gtgcctcagcttgctgaaggaaacgcttctttcgcaacgacgcatgcaacttctgcaggc
gttgctcatgcagtgtcatctcctgtaggtcagagctttggggccccgggagaaaccgca
gccttcaacaacctccaacaagcggtcaaccgcaatatggaggccagtttggccttcccc
tgcttcagggttggctacacgatcacgactgatcagttggatgctttttacaagcaggtg
aagcctaagggcgtcacgatgacagcccttctggccaaagccgtggccttgacgctagtg
cgtcatccccaggtgaatgctgcttacagcaccgctgggatggtgtatccagagcaggtg
aatgttgctgttgcagtggcgatggacgatggcggtctgattacaccggttttgcagaat
gctgatcgcaccgatctctatgagatgtcgcggcagtgggcagatcttgtgaagcggtca
cgcagcaagcagttgcaacccgaggaatacagcactggtactttcaccctttccaatctg
ggcatgtttggcgtggaccgctttgatgcaatcttgccccctggcactggcgcaattttg
gcggtagctgcatcgcggcctgctgtggtggctggaaaggatggctcgattgcggtcaag
cgccagatgcaggtgaacctcactgccgaccatcgcgtgatttatggcgccgatggggcc
gccttcctcaaggatctggcagagctgattgagacgcgggtagagagtttggcgctctaa

DBGET integrated database retrieval system