KEGG   Podarcis muralis (common wall lizard): 114595659
Entry
114595659         CDS       T06059                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04120  Ubiquitin mediated proteolysis
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua04510  Focal adhesion
pmua04621  NOD-like receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114595659 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114595659 (BIRC2)
   04217 Necroptosis
    114595659 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114595659 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114595659 (BIRC2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114595659 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114595659 (BIRC2)
Peptidases and inhibitors [BR:pmua01002]
 Peptidase inhibitors
  Family I32: IAP family
   114595659 (BIRC2)
Ubiquitin system [BR:pmua04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    114595659 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 zf-C3HC Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX RNA_pol_N
Other DBs
NCBI-GeneID: 114595659
NCBI-ProteinID: XP_028581985
LinkDB
Position
4
AA seq 642 aa
MQCFAFRFLFYYGLEVNQICTKLSPRLQTRPILLSYFIVMNIYDSLPSKLRNSSDVSELT
YDLSCELYRMSTFSTFPQNVPVSERSLARAGFYYTGVKDKVKCFSCGLMLDNWKKGDKAL
DKHKQLYPSCNFVKSLTPLNNLGSSFNSAFSPPTAFGLSSSHSPTPAANMDQVGYFSGSF
SSFPHDPVTSRAVEDLSHLRPKTVNYAMSAEDDRLHTFESWPLTFLSPSSLAKAGFYYIG
PADKVACFACGGQLSNWEPKDNAMSEHRRHFPNCPFVEQMCDQTSFTVSNMSMQTYVMRL
NTFKSWPAAVPVQPPRLADAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRC
EYLRHMKGQEFVHQIQVRFPHLLEQLLSTSDTPVDENVEPIIHFGPGENASEDAIMMKTP
VVEAALEMGFSKRLVKQTVQSKILTTGENYKSVNDLVSDLIAAGDEKNEEKVVQAEEVTS
DLSLIRKNRNALFQRLTCVLPILESLLTSKVINDVEYHVIKQKTQTPLQARELIDTILVK
GNTAANIFRNCLQECDFVLYKDLFEEKKMPYIPTEDVSGLPMEEQLRRLQEERTCKVCMD
KEVSIVFIPCGHLVVCKECAPSLRKCPICRGTIKGTVRTFLS
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgcaatgttttgctttcaggtttttattttattatggcctggaagttaatcagatttgc
acaaaactatctcccaggcttcagactcgtcccattctcctatcttatttcatcgtcatg
aacatatatgattcattaccgtccaaactgaggaatagcagtgatgtaagtgaactgacg
tacgatctgtcatgtgaactctacaggatgtccaccttttcaactttccctcagaatgta
cctgtatctgaaaggagtctcgcccgtgctggtttctattacactggtgtgaaagacaaa
gtaaaatgttttagttgtggcttgatgttggataactggaaaaaaggtgacaaggctctg
gacaagcataagcaactctaccctagctgcaactttgtgaagagtttgactccattgaac
aatctcggttcatcatttaattctgccttttcacctccaactgcctttggcctttcttct
tcacattccccgacaccagcagcaaatatggatcaagttggctatttcagtggaagcttt
tcaagctttcctcatgatccagtcacatccagggcagttgaagacttgtcccatttgaga
cctaaaacagtcaattatgcaatgagtgcagaggacgacagactgcacactttcgagtca
tggccactgacatttctgtcaccatcttctttggcaaaagctggattttattacattggg
cctgcggacaaggtggcttgttttgcctgtggtggtcaactgagtaactgggagcctaag
gataatgccatgtcggaacatcggaggcactttccaaactgcccttttgtggaacaaatg
tgtgaccagaccagcttcacagtctccaatatgagcatgcagacctacgtaatgcgcctc
aacactttcaaaagctggccagctgcagttccagttcagccaccgcggcttgcagatgct
ggcttctattatgtgggtcgcaatgatgatgttaaatgtttctgctgtgatggtggactc
aggtgttgggagtctggggatgatccatgggtagaacatgctaaatggtttccaagatgt
gagtacctgcggcatatgaaaggacaagagtttgtccatcaaattcaagtaagattcccc
catcttcttgaacagctgttatccacctcagatacacctgtggatgaaaatgttgagcca
attattcattttggacctggtgagaatgcttcagaagatgcaatcatgatgaaaacccca
gtggttgaagctgccttggagatgggattcagcaaaagactagtcaagcagactgttcag
agtaaaatcttaacaaccggagagaattataaatctgtaaatgatcttgtgtccgacctc
attgctgcaggagatgagaagaatgaagagaaggtggtacaagcagaggaagtgacatca
gatctgtccttaatcaggaagaaccgaaatgcattgtttcagcgcttgacatgtgtgctt
cctatccttgaaagtttattaacatccaaagtaataaatgacgttgaataccatgttatt
aaacaaaaaacccagacaccactgcaagcgagagaactgattgataccatcttggtgaaa
ggaaacacagctgcaaacatattcagaaactgtttacaagagtgtgattttgtattatac
aaagacttgttcgaggagaagaaaatgccttatattccaacagaagatgtttcaggcctg
cccatggaagaacagctgagacgattacaagaagagagaacatgcaaagtttgcatggac
aaggaagtgtccattgtcttcatcccatgtggccacttagttgtgtgtaaagaatgtgcc
ccttcccttagaaaatgccctatatgcagagggacaatcaagggtacagtgcggacattt
ctttcatga

DBGET integrated database retrieval system