KEGG   Podarcis muralis (common wall lizard): 114596983
Entry
114596983         CDS       T06059                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04068  FoxO signaling pathway
pmua04150  mTOR signaling pathway
pmua04210  Apoptosis
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04622  RIG-I-like receptor signaling pathway
pmua04623  Cytosolic DNA-sensing pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114596983 (CHUK)
   04068 FoxO signaling pathway
    114596983 (CHUK)
   04150 mTOR signaling pathway
    114596983 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114596983 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114596983 (CHUK)
   04621 NOD-like receptor signaling pathway
    114596983 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    114596983 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    114596983 (CHUK)
   04625 C-type lectin receptor signaling pathway
    114596983 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114596983 (CHUK)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114596983 (CHUK)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114596983 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmua01001]
    114596983 (CHUK)
Enzymes [BR:pmua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     114596983 (CHUK)
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   114596983 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD APH YrbL-PhoP_reg PNMA
Other DBs
NCBI-GeneID: 114596983
NCBI-ProteinID: XP_028584740
LinkDB
Position
5
AA seq 750 aa
MERPPSLRGGPPGSAACEPWEMRERLGTGGFGNVSLYQHRDLGTKIAIKSCRLELSVKNK
DRWCHEIQIMKKLNHPNIVKACEVPDEMNFLVNDVPLLAMEYCCKGDLRKLLNLPENCCG
LKESQILSLLSDIGYGIQYLHENRIIHRDLKPENIVLQEEGGKIIHKIIDLGYAKDLDQG
SLCTSFVGTLQYLAPELFDNKPYTTSVDFWSFGTVVFESIAGFRPFLHNQQPFTWHDKIK
KKDPKYIFAWEEMTGEVRFSPHLPNPNSLCSIIVEMMESWLQLMLNWDPQQRGGGPDPET
GNLRCFQLMDQILGLKIVHILNMTSAKILSFSLLPEESLHSLQSRIESETGISTGNQELL
LEMGICLDPRKPASQCVIDGVRGWDSYMVYLFDKSKTIYEGPFASRSLSDCVNYIVQESK
IQLPIVQLRKIWAEAVHYIIGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNNMVSASQQ
LKAKLKFFQQSIHLDLEKYSDQMTYGISSEKMLKAWKEMEEKALQCEQAGDIGYLDEQIM
ALHTEIVELQRSPHARRQGELMENLEQRAIELYKQLKPRPPDHSYSDSTEMVKIIVHTVH
TQDRVLKELFKHLSKLLGSKQKIIDLLPKIEVALNNIKEADNSVMQMQAKRQREIWHLLK
IACTQSSAKSPVSSNVDGTITSSVPALLSQTSPGNALQPLSSMETSRNVPPFAHLIEENL
SYLDNFSTIIQEAKRDQSNSMMSLDWNWLN
NT seq 2253 nt   +upstreamnt  +downstreamnt
atggagaggccgccgtccctccgcgggggtccgcccggcagcgccgcctgcgagccctgg
gagatgcgggagcggctcggcaccggcggcttcggcaacgtctcgctctaccagcaccgg
gatctgggtacgaagatagcaatcaagtcatgtcgcttggaactaagtgtgaaaaacaaa
gatcggtggtgccatgagatccagatcatgaaaaagctgaaccatcccaatattgtaaaa
gcctgtgaagtgcctgacgagatgaatttccttgtcaatgatgtcccacttttggctatg
gaatattgctgcaaaggagatctcaggaagctgttgaacttaccggaaaattgctgtggc
cttaaagagagtcaaatactttctcttcttagcgacatcggttatggtatccagtacttg
catgaaaacagaataatacacagggacctaaaacctgagaatattgttcttcaggaagaa
ggtggaaaaataattcacaaaataatagacttgggatatgccaaggatctggatcaagga
agcttatgcacatcttttgttgggaccttacagtacttggcaccagaactctttgataat
aagccgtatacaacttctgtagacttctggagctttggaactgttgtctttgagagcatt
gcaggatttagaccatttttacataaccagcagccttttacctggcatgataaaatcaag
aagaaagatccgaaatacatttttgcgtgggaagagatgactggggaagttagattcagt
cctcatctgccaaatcccaacagcctctgcagtataattgtagaaatgatggagagctgg
ctgcaactgatgctaaattgggatccacagcagagagggggtggtccagacccagaaact
ggtaatttgagatgtttccaattaatggatcaaatactgggtttgaagatagttcacatc
ttaaatatgacttctgccaagatcctgtctttttcattgctccctgaggaaagtctccat
tctctccagtctcgcattgagtcggagactgggatcagcacagggaaccaagagcttttg
cttgagatgggaatttgcctagaccctcggaagccagcctctcagtgtgttattgatggc
gtaagaggctgggacagctacatggtttatttgtttgataaaagcaaaactatctacgaa
ggcccctttgcttctaggagtctgtctgactgtgtaaattatattgtgcaagagagcaaa
attcagctgcccatcgtgcagcttcgtaagatatgggctgaagctgtgcattacatcatt
ggactaaaagaagattacagccggctgttccaagggcaaagagctgcaatgctgagtctt
cttaggtacaatgccaatttaaccaagatgaaaaacaacatggtgtcagcatctcagcag
ctgaaagcaaagctgaaattctttcagcagagcatccaccttgacttggagaaatacagt
gatcagatgacatacgggatatcctcggaaaagatgctgaaagcctggaaagaaatggaa
gaaaaggccttgcagtgtgaacaggctggagatattggctacttggatgagcagatcatg
gctttgcacacagagattgtagaattgcagaggagtccccatgcacgacgtcagggcgaa
ctcatggagaatcttgagcaaagagctatagaactctacaagcaattaaaaccaagaccc
ccagatcattcctacagtgacagcacagagatggtgaagatcatagtccatacagttcac
actcaagatcgcgtgctcaaggaactcttcaaacatcttagcaaactgttgggtagtaaa
cagaagattattgatttgcttccaaagattgaagtggctctgaacaacatcaaagaggct
gacaattcagtgatgcagatgcaggcgaaaaggcagcgggaaatctggcatttgctgaaa
attgcttgcacccagagttctgccaaatctcctgttagttccaacgtggatggcacaatt
acatcctcagtgcctgcattgctctcgcagacatcaccaggaaatgcgcttcaacctctt
tcttctatggaaacatctagaaatgtgccaccgtttgcacatttgatagaagaaaatcta
agctacctcgacaattttagcactattatacaagaagcaaaacgtgaccagagtaacagc
atgatgagtctcgattggaattggctgaattag

DBGET integrated database retrieval system