KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107298366
Entry
107298366         CDS       T05763                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04141  Protein processing in endoplasmic reticulum
pmur04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107298366
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107298366
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmur03000]
    107298366
Transcription factors [BR:pmur03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107298366
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Docking YabA ZapB
Other DBs
NCBI-GeneID: 107298366
NCBI-ProteinID: XP_029142340
LinkDB
Position
Unknown
AA seq 386 aa
MAALASELLLLSDSSRFRADNLLSSEDWDAGLYSCLDNDGDVAAELFPCLEHSIMDHNGT
RSAFGDGFDLDMETMPPDPPWDPLQESLFPELQVKSEPVSPASSHCSDSSLASSDSSAAG
SSSAELSEQVAGPDDVIGVKTEHPPTPPCMFGDVLLPPFGTVHINVVPASETGKPAAPNK
TESILSRKPPIQPKPVVVTTVPGQPATSSSKTILLQPVPVTQSQTVNSGISVPAQSVVIS
QSELLHLPVSGLIKVQSPVKEVLSPKPAPSIPKPEAKTIIPAPAQIGPCNQEIDIKVLKR
QQRMIKNRESACQSRRKKKEYLQGLESRLREALAENERLRRENAILRRRLDGVLDENSDL
KFGSGNRKVICVMVVLLFIAFNFGPV
NT seq 1160 nt   +upstreamnt  +downstreamnt
atggcggcgctggcttcggagttgctgcttttgagcgattcaagccgcttccgggcagat
aacctgctgagcagcgaggactgggatgcaggtctttacagctgtttggataatgatgga
gatgtggcagctgaacttttcccttgtcttgaacacagcattatggaccataatggtacc
cgttctgcgtttggtgatgggtttgatctggacatggaaactatgcctccagacccacct
tgggatcctttgcaagaatctctgttcccagagttgcaagtaaaatctgagccagtctcc
cctgcttcgtctcactgctccgattcatcgttggcctcctccgattcttctgcggcaggc
tcctcttccgccgaactctcagagcaggttgctggaccagatgatgtgattggagtgaag
acagagcatcctcccacccctccgtgcatgtttggagacgtccttttacctccctttgga
acggtacacataaatgtagtcccagcttctgagacaggaaaaccagcagctcccaataaa
acagagagcattctgagccggaaaccccccattcaaccaaagcccgtggtggtaaccact
gtcccaggacagccagcaacctcttccagtaagaccatcttgttacagccagtacctgta
acccagtcacagactgtcaactctggaatctcagttccagcacagagtgttgtgatttcc
caatctgagctactgcatctcccagtgtctggtttgatcaaggttcagtctccagtgaag
gaggttctctcacctaaaccagcaccctcaatccccaagccagaagctaaaactatcatc
cctgcaccagcacagataggaccctgcaaccaagagattgatatcaaggtcctgaaaagg
cagcagcggatgataaagaaccgtgaatcggcttgtcagtcgcgccgaaaaaagaaggaa
tacctccaaggattggaatcccggctgcgagaggccttagcggagaacgagcggctgcgg
cgggaaaatgctatccttcggcgccggctagatggtgtcttggacgagaacagcgatctg
aagtttggctccgggaaccgaaaagttatctgtgtcatggttgtgctgctcttcatagcc
ttcaattttgggcctgtcag

DBGET integrated database retrieval system