KEGG   Polaromonas naphthalenivorans: Pnap_2483
Entry
Pnap_2483         CDS       T00459                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00624  Polycyclic aromatic hydrocarbon degradation
pna00626  Naphthalene degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Module
pna_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Pnap_2483
   00624 Polycyclic aromatic hydrocarbon degradation
    Pnap_2483
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     Pnap_2483
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     Pnap_2483
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase KR GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: ABM37787
UniProt: Q3S4C8
LinkDB
Position
complement(2621326..2622105)
AA seq 259 aa
MNTQQVVAITGAGSGIGFELVRSFKAAGYRVSALVRNEEQEAGLRSEFKDDIEIVAGDVR
DHATNEKLVKQTVAKFGRLDCFIGNAGIWDYMLSIDEPWEKFSGSFDEIFDINVKSYFSG
ISAALPELKKTNGSVVVTASVSSYAVGGGGSCYIASKHAVLGMVKALAYELAPHIRVNGV
APGGTVTSLAGPASAGFDKTKMKDIPGIDDMIKGLTPLGFAARPEDVVAPYLLLASREQG
KFITGTVISIDGGMALGRK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaacacacagcaagttgttgccatcactggcgccggctcgggcattggtttcgagttg
gttcgctcttttaaggcagccggttatcgcgtatctgcactcgttcgcaacgaggagcaa
gaggcgggtcttcgcagtgaattcaaagacgacattgagatcgtggcgggcgatgtccgt
gatcacgccaccaatgagaagctggttaaacagacggttgccaagttcgggcgcctggat
tgcttcatcggaaatgccgggatatgggattacatgctgagcatcgatgagccttgggag
aaattctcgggcagtttcgacgagatatttgacatcaacgtcaaaagctatttcagcggc
atcagcgcggccttgccggagctcaaaaagacgaacggatcggtggtggtgacggcttcc
gtttcttcctatgcggtcggtggcggcggttcttgctacattgccagcaaacatgcggtg
ctgggcatggtcaaggctttggcctacgaattggctccgcacatccgggtcaatggcgtt
gcgccaggtggcacggtcacttctttggctggcccggcaagcgctggcttcgacaaaacc
aaaatgaaagacattcccggcatcgatgacatgatcaaaggcctgactcccctggggttc
gcggcaaggcccgaggacgtggtggcaccgtaccttttgctggcctcccgagaacaaggg
aagttcatcactggcacggtgatcagcattgatggcggcatggcgctcggccgcaagtga

DBGET integrated database retrieval system