KEGG   Porphyrobacter neustonensis: A9D12_06790Help
Entry
A9D12_06790       CDS       T04416                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pns  Porphyrobacter neustonensis
Brite
KEGG Orthology (KO) [BR:pns00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A9D12_06790
Enzymes [BR:pns01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A9D12_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored K_oxygenase DUF2190 FAD_binding_3 HI0933_like DAO NAD_binding_8 Thi4 FMO-like
Motif
Other DBs
NCBI-ProteinID: ANK14164
UniProt: A0A192D8S2
LinkDB All DBs
Position
complement(1446383..1447972)
Genome map
AA seq 529 aa AA seqDB search
MLDAAMQTQLKAYLANLREGVELVASLDDSEKSRQTRQLIEQIAAQHDLVTARFDGTDDR
KPSFIIRRASDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVDADLIEQVRALEGDFN
FEMFFSLSCHNCPDVVQALTLMALENPRITATLIEGGTFQDEVERRDIMAVPATFLNGEP
FYNGKMELAEILSKLDVNADARAAEKLSAKAPFEVLVVGGGPAGAAAAVYTARKGFSTGI
AAERFGGQLNDTLGIENLPGTPYTEGPKLTDSLKSHVGQYDIDLMDLARAVELRASKDVG
GFHEVVMANGATLRARSLILSTGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAGIVGHVTLVEFDVKLRADEVLQRKLRSMPNVEIITNGQTTEVLGD
GTRVNGMVVKDRASGDERRIDLEGVFVQIGLVPNTEWLQGTGLELSKHGEIVTDDHGATN
IPGIYAAGDCTTVPHKQIVVAMGEGAKAGLGAFDFLIRNEPVEAIAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccgcaatgcagacccagctcaaagcctatctggcgaacctgcgcgaaggc
gtggaactggtcgcctcgctggacgacagcgagaagtcgcgccagacccgccagcttatc
gaacagatcgccgcgcagcacgatctcgtcaccgcgcgtttcgacggcaccgacgatcgc
aagcccagcttcatcatccgccgcgcgagcgacgcggagaagtgggtgcggttcgcaggg
ctcccgatgggtcacgaattcacgtcgctggtgctcgcgctgctgtgggccggcggccac
ccgcccaaggtcgacgccgatctgatcgaacaggtccgcgcgctcgaaggcgatttcaat
ttcgagatgttcttctcgctctcgtgccacaactgccccgacgtggtgcaggcgctcacg
ctgatggcgctcgaaaacccgcgcatcaccgcgacgctgatcgaaggcggcaccttccag
gacgaggtcgagcgccgcgacatcatggccgtgcccgcgactttcctgaatggcgagccg
ttctacaacggcaagatggaactggccgagatcctctcgaagctcgacgtcaatgccgat
gcgcgcgctgccgagaaactcagcgccaaggccccgttcgaagtgctggtggtcggcggc
ggccctgccggtgcggctgccgcggtctataccgcgcgcaagggtttcagcaccgggatc
gcagcggaacgcttcggcgggcagctcaacgatacgctcgggatcgagaacctgccgggc
acgccctataccgaaggccccaagctgaccgacagtctcaagagccacgtgggccaatat
gacatcgacctgatggacctcgcccgcgcggtcgaactgcgcgcaagcaaggatgtcggc
gggttccacgaagtcgtgatggccaacggcgcgaccctgcgcgcgcgctcgctgatcctg
tcgaccggcgcacgctggcgcaacctcggcgttccgggcgaagcggaatatcgcaacaag
ggcgtggcctattgcccgcactgcgatggcccgctgttcaagggcaagcgcatcgcggtg
atcggcggcggcaattcgggtgttgaagcggcgatcgacctcgccggcatcgtcggtcac
gtcacgctggtcgaattcgacgtgaagctgcgcgccgacgaagtgcttcagcgcaaactg
cgctcgatgccgaacgtggaaatcatcaccaatggccagaccaccgaggttctgggcgat
ggcacccgcgtgaacggcatggtggtgaaagaccgcgcgagcggggacgaacgccggatc
gatctggaaggcgtattcgtccaaatcggccttgtccccaacaccgaatggctgcagggc
acgggcctcgaactgtcgaagcacggcgaaatcgtcaccgacgatcacggcgcgaccaat
atccccggcatctatgccgcgggcgattgcaccaccgtgccgcacaagcagatcgtggtt
gcgatgggcgaaggcgcgaaggcgggtctgggcgcgttcgactttctgatccgcaacgag
ccggtggaagcgattgcgcaggcggcgtaa

DBGET integrated database retrieval system