KEGG   Porphyrobacter neustonensis: A9D12_07005Help
Entry
A9D12_07005       CDS       T04416                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pns  Porphyrobacter neustonensis
Pathway
pns03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pns00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A9D12_07005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pns03400]
    A9D12_07005
Enzymes [BR:pns01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A9D12_07005
DNA repair and recombination proteins [BR:pns03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A9D12_07005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ANK12734
UniProt: A0A192D4M7
LinkDB All DBs
Position
1494990..1497506
Genome map
AA seq 838 aa AA seqDB search
MGKRSDPLASYNAKRDFTKTAEPKGEVPANGGAGGRRFIVQKHAASRLHWDLRLEIDGVL
KSWAVTKGPSRDPAVKRLAVRTEDHPLSYAQFEGTIPAREYGGGTVMLWDRGTWAPIAGK
SAADLEDGHLHFTLDGERMKGEWLLIRLKPRPGEKRENWLLRKIGDDHAAPDEALVEHHL
TSVSTGRSMAEIAAGTRGSAASARADQKDVAAGMAKATKPGAKRPRRRLAAKLPGFRAPQ
LATLVDAVPTGNGWMHEIKFDGYRALIAARGEDVRVFTRSGQDWTAKFGPLVAAIAALDL
PAALIDGEIVAHDAVGNPDFSALQALLKRGRGAQGPDDSLAFYAFDLLEADGVDLTALAN
IERKERLEALLAAAEPPIHVADHVIGAGEQLLRAMCGAGQEGIISKAIDAPYLHKRSHSW
VKVKCIRRQEFVIVGWKASTTNARPFASLLLAQHEDGSLAYKGNVGTGFGDEELGRMAAR
LRRLERKTPPLDVDRAAARGVTWVKPALVAEIAFAEFTAQGRVRHASFAGLRADKPAREV
ASETPAPPPVTASDVDITNRDRVIFPDTGQTKGELADYYAAIAPAMLPFVAERPVSLVRC
PQGRARKCFFQKHDSGALGDAVRHVPIRQKDGGSEDYLFVTDQRGILQCVQMGTIEFHAW
GSRVDAVDQPERMIFDLDPDEGLDFEAVKRAATEIRAHLADLGLISFAMLSGGKGVHVVI
PLTPGHDWDTHKDFARRFAEALSLAAPDRFTATMSKARRSGKIFIDWLRNQRGATAVIPF
SARARAGAPVAVPIAWDELAKFEDAHPFAIGDAEALLHRAKSPALQGWGFAAQSLPAF
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcgttccgatccgctcgcatcctacaacgccaagcgcgatttcaccaagacc
gccgaaccgaagggcgaggtgcctgccaatggtggcgcaggcgggaggcgtttcatcgtc
cagaaacacgccgcctcacggctgcactgggacctgcggctcgaaatcgacggtgtcctc
aagagctgggccgtcaccaaggggccaagccgcgatcctgccgtcaaacgcctggcggtt
cgcaccgaggatcatccgctttcctatgcgcagttcgagggcacgattccggccagagaa
tatggcggcgggacggtgatgttgtgggaccgcggcacatgggcaccgatcgcgggcaag
agcgcagccgatctcgaagacgggcaccttcacttcacgctcgacggcgagcggatgaag
ggggaatggctgctgatccggttgaagcccaggcccggcgaaaagcgcgagaactggttg
ctccgcaagatcggcgacgaccacgctgcgcctgacgaagcgctggtcgagcatcacctg
acgagtgtttcgacaggccgatcgatggccgaaattgccgcaggcacacgaggcagcgcc
gcctctgcccgcgccgatcaaaaagacgttgctgcgggcatggcaaaggctaccaagccc
ggcgcgaaacgcccccgtcggcgccttgccgccaaactgcccgggttccgggcgccgcag
ctggcgacgctggtcgacgcggtgccgaccggcaatggctggatgcacgagatcaagttc
gatggataccgcgcgctgatcgcagccaggggcgaagatgtgagggtcttcacccgttcg
ggccaggactggaccgccaagtttggcccgctggtggcggcaatcgccgcgctcgatctc
ccggcggcactgatcgatggcgagatcgtcgcgcatgatgccgtcggcaatcccgatttt
tcggcattgcaagcgctcctcaaacgcggtcgcggcgcgcaggggccggacgactccctg
gctttctacgccttcgatctgctcgaagcggacggtgtggatctgaccgcacttgccaat
atcgagcgcaaggaaaggctcgaagcgctgctcgccgccgcggaacctccgatccatgtc
gccgatcatgtcatcggcgcaggtgaacaactcctccgcgccatgtgcggtgccgggcag
gaaggcatcatctccaaggcgatcgatgcgccttacctccacaaacgcagccatagctgg
gtgaaggtcaagtgcatccggcggcaggaattcgtgattgtcggatggaaggcctccacc
acgaatgcgcgcccctttgcctcgctgctgctggcccagcacgaagacggttcgctggca
tacaagggcaatgtcggcaccggtttcggcgacgaggaactgggccgcatggcagcgcgg
ctgagacggctggagcgcaaaacgccgccgctcgacgtcgaccgcgcagccgcgcgaggc
gtcacctgggtaaagccggcattggtcgccgaaatcgcctttgccgaattcacggcgcaa
gggcgggtgcgtcacgccagtttcgccgggctgcgcgccgacaagcccgcgcgcgaggtc
gcctccgagacacccgcgccgccgccagttacggcaagcgacgtcgacatcaccaatcgc
gatcgcgtgatctttcccgatacaggccagaccaagggcgaactggcggactattatgcg
gcgatagcgccggccatgctgcccttcgttgccgagcgaccggtcagcctggtgcgttgt
ccccaaggccgtgcgcgcaaatgcttttttcagaaacacgacagcggtgcgctcggcgat
gcagtgcgacacgtcccgatccggcaaaaggacggcggaagcgaggactatctgttcgtc
accgaccagcgcggcatcctgcaatgcgtgcaaatgggaacgatcgagttccacgcctgg
ggatcgcgggttgacgcggtcgatcagcccgagcgcatgatcttcgacctcgatcccgac
gaggggctggacttcgaggccgtcaagcgcgccgcaaccgagattcgcgcgcatctcgcc
gatctcggtctgatcagctttgccatgctgtcaggagggaagggcgttcatgtggtcatc
ccgcttacgcccggacatgactgggacacgcacaaggacttcgcgcggcggtttgccgaa
gccttgtcgctcgccgcgccggatcgtttcaccgccaccatgagcaaggccaggcgcagc
ggaaaaatcttcatcgactggctgcgcaatcaacgcggcgcgaccgcggtgataccattt
tccgcccgtgcccgcgccggcgcgcccgtcgcggttccgatcgcatgggacgagctcgcg
aaattcgaggacgcccatccctttgcgatcggcgatgccgaagcgttgcttcaccgggcc
aagtctcccgcgttgcaaggctggggctttgctgcgcagtcgctcccggcgttttga

DBGET integrated database retrieval system