Erythrobacter neustonensis: A9D12_10700 Help Entry A9D12_10700       CDS       T04416                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pns  Erythrobacter neustonensis Pathway pns01100   Metabolic pathways pns01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pns00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9D12_10700   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9D12_10700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ANK13333 UniProt:  A0A192D4D0 LinkDB All DBs Position 2305896..2306132 Genome browser AA seq 78 aa AA seqDB search MSDTADRVAKIVVEHLGVEAEKVTQDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgctgaccgggtggcgaagattgtcgtcgagcatctcggcgtcgaggcc gaaaaggtcactcaggatgcaagcttcatcgatgatcttggcgcagacagcctcgacatc gtcgagctggtgatggccttcgaagaggaattcggtgtcgaaattcccgacgatgcggcc gaaaagatcaccaccgttggtgacgcgaccaagtacatcgaagaacacaagggctga

DBGET integrated database retrieval system