KEGG   Polynucleobacter asymbioticus: Pnuc_1535Help
Entry
Pnuc_1535         CDS       T00502                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pnu  Polynucleobacter asymbioticus
Brite
KEGG Orthology (KO) [BR:pnu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pnuc_1535
Enzymes [BR:pnu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Pnuc_1535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 K_oxygenase Thi4 Thioredoxin_9 FMO-like DUF3467 Thioredoxin_4 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ABP34749
UniProt: A4SZ35
LinkDB All DBs
Position
1603971..1605551
Genome map
AA seq 526 aa AA seqDB search
MLDTNLKTQLKAYFEKIVDPITLVASLDSSPSSAQMLELLTEVAEQSEKITLQTDGKSGH
VPSFTVGKSGSDARITFSGLPMGHEMTSFILAILQASGYPPKVEEDVIARIKTLNGQFKF
QTFISLSCHNCPDVVQALNLMAALNPQIEHEMIDGALFQGLVDQYQIMAVPTVILNGEVF
GQGRMGVEEIVAKLDTGSSEEEAAKLNAKDSFDVLVIGGGPAGSAAAIYAARKGIRTGIV
AERFGGQVMDTLGIENFISVSHTEGPKLVQALEQHVKSYEVDIMNLQRANALRKTANGIE
VELANGAVLNSKSVILSTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVSHVTLIEFDSQLRADAVLQVKLASLPNVTVIKSALTKEVLGDGSKV
NGLRYQDRISNEEHAIELEGIFVQIGLLPNTEWLKGAVELSPRGEVMVDAKGETSVPGIF
AAGDCTTVPYKQIIIAMGEGAKASLGAFDYLIRHSVSEEAPVKVAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaatctcaaaacccaattaaaagcgtacttcgaaaagatcgtagatccg
atcactcttgtagctagcttagatagcagcccttcctcagcgcaaatgcttgaactcctc
actgaagttgctgagcagtctgagaagatcaccctccaaacagatggtaagagcggccat
gttccgagttttactgttggcaagtctggtagtgatgcgcgcattaccttttctggattg
ccaatgggtcatgaaatgacctctttcatcctagcaattttgcaagccagtggttaccca
ccaaaagttgaagaagatgttattgcacgcattaagactttgaatggtcaatttaagttt
cagacatttatttccttgtcatgccataactgtccagatgttgtgcaagccctcaatctc
atggctgcattaaatccacagattgaacatgaaatgattgatggcgccctctttcagggt
ctagtagatcaatatcaaattatggccgtaccaaccgtcattctcaatggtgaagtattc
ggccaaggcagaatgggcgtagaagaaattgttgccaaactcgatactggaagctcagag
gaagaggccgccaaactcaatgccaaagatagctttgatgttctcgtcattggcggtggc
cctgctggatctgctgccgctatttatgctgctcgtaaaggtattcgcaccggtatcgtt
gctgagcgttttggtggccaggtaatggataccttaggaattgaaaactttatctctgtt
tcgcacacagaaggtcctaagcttgttcaggctttagagcaacacgtcaagagttacgaa
gttgacattatgaatctgcagcgcgctaatgcactgcgtaagaccgctaacgggattgaa
gttgagttagcaaacggcgcagtgttaaatagcaagtccgttatcttaagcactggcgca
cgctggagagagatgaatgttcctggtgaacaagaatatcgcaacaaaggggttgcttat
tgcccgcattgcgatggaccactctttaaaggtaaacgtgttgccgtaatcggcggcgga
aattctggtgtagaagcagctattgacctcgccggtctagtaagtcacgttaccctcatt
gaatttgacagtcagcttcgcgcagacgctgtattgcaagtaaaactagctagcctaccg
aatgtgaccgttatcaagagcgccctcactaaagaagtattgggtgacggcagtaaagta
aatggcttgcgctatcaagatcgcatcagcaatgaagagcatgcaattgaactagaaggt
atcttcgtacaaatcggtttattgccaaacactgagtggttaaaaggtgctgttgaactc
tcaccacgtggtgaggtgatggttgatgccaaaggcgaaacctctgttcccggtatattt
gcagccggcgattgcactaccgttccttacaagcaaatcattattgcaatgggtgaaggt
gcaaaagcatcattaggagcatttgattacctcatccgccattctgtaagcgaagaggct
ccggtaaaagtggcagcttaa

DBGET integrated database retrieval system