KEGG   Polynucleobacter paneuropaeus: DPM16_02030Help
Entry
DPM16_02030       CDS       T05507                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
poh  Polynucleobacter paneuropaeus
Brite
KEGG Orthology (KO) [BR:poh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DPM16_02030
Enzymes [BR:poh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DPM16_02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored FAD_binding_2 FAD_binding_3 DAO Thioredoxin_9 AlaDh_PNT_C Thi4 K_oxygenase NAD_binding_8 Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AWW44113
LinkDB All DBs
Position
complement(376833..378407)
Genome map
AA seq 524 aa AA seqDB search
MLDSNIKAQLKTYFERIVDPIVLTASLNDNPKSAEMLELLNEVAEQSDKITVNTDGNAEH
KPSFTVAKVGDAARITFAGLPMGHEMTSFILAILQASGYPPKVEEEVLNSIRGLSEKMRF
QTFISLSCHNCPDVVQALNLMAALNPNIEHEMIDGALYQGLVDQYQIMAVPTVILNGEVY
GQGRMTVEEIVAKLDSGNAKEVAKKLSAKEPFDMLIIGGGPAGSAAAIYSARKGIRTGII
AERFGGQLMDTLGIENLISVKETVGPKLTQALEQNVKSYDVDIMNLQRAKALRKTDSGLE
VELENGAILKSKSMIISTGARWRSMNVPGEDEYRNKGVAYCPHCDGPLYKGKRVAVIGGG
NSGVEAAIDLAGIVSHVTLIEFDSKLRADAVLQNKLNSLPNVTVLTSALTTEALGDGKKI
NGLRYKDRNKDSEHVIELEGIFVQIGLLPNTDWLKGTVDLSPRGEILISDKGETSLPGVF
AAGDCTTVPYKQIIISMGEGAKASLGAFDYLIRSSVPEPELAVH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttagatagcaacattaaggctcaattaaaaacctacttcgagagaatcgttgaccct
atcgttttgacggcgagtctgaatgacaatcccaaatcggccgaaatgcttgagctttta
aatgaagttgctgagcagtcagacaaaattactgtcaatactgatggcaatgctgagcac
aagcccagttttacggtagccaaggtaggagatgcggcacgcattacctttgccggcttg
cccatgggccatgagatgacttcctttatcttggcgatcttgcaagcaagtggctatccg
cctaaagttgaggaagaggtcttaaatagcatccgcggcttatcagaaaagatgcgcttt
cagacctttatctccctgtcttgccacaactgccctgacgtggttcaggccctcaacttg
atggctgcactcaatcccaatatcgaacatgaaatgatcgatggtgccctttatcaaggt
ttggtagatcaataccaaatcatggctgtgcctaccgtgattctcaatggtgaagtgtat
ggtcaaggccgtatgactgtagaagagatcgtcgccaaactggatagcggtaatgctaaa
gaagtcgccaagaaactcagtgctaaagaaccattcgacatgttgattattggtggtggc
cctgcaggttcagctgcagcaatctattcagcacgtaagggtattcggacgggcatcatt
gctgagcgcttcggcggtcaactgatggatacgctcggtattgagaacctcatctccgtt
aaagaaaccgtgggacctaagctaactcaggctttggagcaaaacgtcaaaagctatgat
gtcgacatcatgaacttgcaacgtgctaaagccttgcgcaagaccgactcaggtttagag
gtcgagcttgagaatggtgcgatcctcaaaagcaaatccatgatcattagtaccggcgct
cgctggagatcgatgaacgtacctggcgaggatgagtatcgcaataaaggcgtagcctat
tgcccacattgcgatggtcccttatacaaaggcaagcgtgtggcagtgattgggggcggt
aactctggcgtagaggctgccattgatttggccggcattgttagtcacgtgaccctgatt
gagtttgatagcaaattgcgggcagatgccgttcttcaaaacaagctcaacagcttgccg
aacgtcacagtactgactagtgcgctaactaccgaagcactgggcgatggcaagaagatt
aatggcctgcgctataaagatcgtaataaggacagcgagcatgtgattgaacttgaaggc
atctttgtacagattggcttgttgcctaataccgattggctcaaaggtacggttgattta
tcaccccgtggtgagattttgattagcgataagggtgaaacctcattgccgggcgtcttt
gcagcaggcgattgcactactgtgccctataagcaaatcatcatctccatgggtgaaggt
gccaaggcttctttaggagcatttgattacctgattcgctcttcagttcccgagcctgaa
ttagcagtccattag

DBGET integrated database retrieval system