KEGG   Pongo abelii (Sumatran orangutan): 100127093
Entry
100127093         CDS       T01416                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04714  Thermogenesis
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04931  Insulin resistance
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon05016  Huntington disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100127093 (CREB3L2)
   04024 cAMP signaling pathway
    100127093 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    100127093 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    100127093 (CREB3L2)
   04152 AMPK signaling pathway
    100127093 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100127093 (CREB3L2)
   04922 Glucagon signaling pathway
    100127093 (CREB3L2)
   04915 Estrogen signaling pathway
    100127093 (CREB3L2)
   04926 Relaxin signaling pathway
    100127093 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    100127093 (CREB3L2)
   04918 Thyroid hormone synthesis
    100127093 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    100127093 (CREB3L2)
   04916 Melanogenesis
    100127093 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    100127093 (CREB3L2)
   04927 Cortisol synthesis and secretion
    100127093 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100127093 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100127093 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    100127093 (CREB3L2)
   04728 Dopaminergic synapse
    100127093 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    100127093 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100127093 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100127093 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100127093 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100127093 (CREB3L2)
   05020 Prion disease
    100127093 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    100127093 (CREB3L2)
   05031 Amphetamine addiction
    100127093 (CREB3L2)
   05034 Alcoholism
    100127093 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100127093 (CREB3L2)
   04934 Cushing syndrome
    100127093 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100127093 (CREB3L2)
   05161 Hepatitis B
    100127093 (CREB3L2)
   05163 Human cytomegalovirus infection
    100127093 (CREB3L2)
   05165 Human papillomavirus infection
    100127093 (CREB3L2)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100127093 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 100127093
NCBI-ProteinID: NP_001124550
Ensembl: ENSPPYG00000018036
UniProt: Q5RCM9
LinkDB
Position
7
AA seq 520 aa
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSTEVEPSPMSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDF
PSTTIKTEPITDEPPPGLVPSVTLTITAISTPFEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEEPSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagggcgtgctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggacggcgaggccctcatgtaccacacgcacttctcagaacttctg
gatgagttttcccagaacgtcttgggtcagctcctgaatgaccctttcctctcagagaag
agtgtgtcaacggaggtggaaccttccccgatgtccccagcgcctctcatccaggctgag
cacagctactccctgtgcgaggagcctcgggcccagtcgcccttcacgcacattaccacc
agtgacagcttcaatgacgatgaggtggaaagtgagaaatggtacctgtctacagacttc
ccttcaacgaccatcaagacagagccaattacagacgaaccacccccaggactggttccg
tctgtcactctgaccatcacagccatctccaccccatttgaaaaggaggaacctcctctg
gaaatgaatactggggttgattcctcgtgccagaccattattcctaaaattaagctggag
cctcatgaagtggatcagtttctaaacttctctcctaaagaagccccagtggaccacctg
catttgccacccacccccccgagcagtcacggcagtgactcagagggcagcctgagtccc
aacccacgcctgcaccccttcagcctgcctcagacccacagcccctccagagctgcaccc
cgggccccctccgccctctccagctcccctctcctcacggctcctcataaactgcaggga
tcaggccctctggtcctgacagaggaggagaagaggaccctgatcgctgagggctatccc
atccccaccaaattgcccctgacaaaatcagaggagaaggccctgaagaaaattcggagg
aagatcaagaataagatttctgcccaggaaagtaggagaaagaagaaggaatacatggac
agcctggagaaaaaagtggagtcttgttcaactgagaacttggagcttcggaagaaggta
gaggttctagagaacactaataggactctccttcagcaactccagaagcttcagactttg
gtgatgggcaaggtttctcgaacctgcaagttagccggcacgcagactggcacctgcctc
atggttgtggtgctgtgctttgccgttgcattcggcagcttctttcaaggctacgggccc
tatccttctgccaccaagatggctctgcccagccagcattccctgcaggagccctacaca
gcctccgtggtgagatccaggaacctgctgatctacgaggaacattctcccccagaggag
ccgtccagcccgggctccgctggggagctggggggctgggatagaggttcctccctgctc
agggtgtcagggctggagtccaggccggatgtggatcttccccatttcattatctcgaat
gagaccagcctggagaagtcagtgcttttggagctgcagcagcacctggtcagcgccaaa
ctggaggggaatgaaacactaaaagttgtagaactcgacagaagagtgaacaccactttc
taa

KEGG   Pongo abelii (Sumatran orangutan): 100294619
Entry
100294619         CDS       T01416                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04380  Osteoclast differentiation
pon04612  Antigen processing and presentation
pon04668  TNF signaling pathway
pon04710  Circadian rhythm
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04931  Insulin resistance
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon05016  Huntington disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100294619 (CREB1)
   04024 cAMP signaling pathway
    100294619 (CREB1)
   04022 cGMP-PKG signaling pathway
    100294619 (CREB1)
   04151 PI3K-Akt signaling pathway
    100294619 (CREB1)
   04152 AMPK signaling pathway
    100294619 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100294619 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    100294619 (CREB1)
   04922 Glucagon signaling pathway
    100294619 (CREB1)
   04915 Estrogen signaling pathway
    100294619 (CREB1)
   04926 Relaxin signaling pathway
    100294619 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    100294619 (CREB1)
   04918 Thyroid hormone synthesis
    100294619 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100294619 (CREB1)
   04916 Melanogenesis
    100294619 (CREB1)
   04924 Renin secretion
    100294619 (CREB1)
   04925 Aldosterone synthesis and secretion
    100294619 (CREB1)
   04927 Cortisol synthesis and secretion
    100294619 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100294619 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100294619 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    100294619 (CREB1)
   04728 Dopaminergic synapse
    100294619 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100294619 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    100294619 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100294619 (CREB1)
   04713 Circadian entrainment
    100294619 (CREB1)
   04714 Thermogenesis
    100294619 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100294619 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100294619 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100294619 (CREB1)
   05020 Prion disease
    100294619 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100294619 (CREB1)
   05031 Amphetamine addiction
    100294619 (CREB1)
   05034 Alcoholism
    100294619 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100294619 (CREB1)
   04934 Cushing syndrome
    100294619 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100294619 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100294619 (CREB1)
   05161 Hepatitis B
    100294619 (CREB1)
   05163 Human cytomegalovirus infection
    100294619 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100294619 (CREB1)
   05165 Human papillomavirus infection
    100294619 (CREB1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100294619 (CREB1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100294619 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 100294619
NCBI-ProteinID: NP_001153276
Ensembl: ENSPPYG00000013115
UniProt: Q5RD15
LinkDB
Position
2B
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactctagtgcagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcgcctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagctgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagacgtacaaacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggtccgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaaacacttaaggacctttactgccacaaatca
gattaa

KEGG   Pongo abelii (Sumatran orangutan): 100431578
Entry
100431578         CDS       T01416                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4-like
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04137  Mitophagy - animal
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04932  Non-alcoholic fatty liver disease
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100431578
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431578
   04668 TNF signaling pathway
    100431578
   04022 cGMP-PKG signaling pathway
    100431578
   04151 PI3K-Akt signaling pathway
    100431578
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100431578
  09143 Cell growth and death
   04210 Apoptosis
    100431578
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100431578
   04922 Glucagon signaling pathway
    100431578
   04912 GnRH signaling pathway
    100431578
   04915 Estrogen signaling pathway
    100431578
   04926 Relaxin signaling pathway
    100431578
   04935 Growth hormone synthesis, secretion and action
    100431578
   04918 Thyroid hormone synthesis
    100431578
   04928 Parathyroid hormone synthesis, secretion and action
    100431578
   04925 Aldosterone synthesis and secretion
    100431578
   04927 Cortisol synthesis and secretion
    100431578
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100431578
  09156 Nervous system
   04725 Cholinergic synapse
    100431578
   04728 Dopaminergic synapse
    100431578
   04720 Long-term potentiation
    100431578
   04722 Neurotrophin signaling pathway
    100431578
  09149 Aging
   04211 Longevity regulating pathway
    100431578
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100431578
  09162 Cancer: specific types
   05215 Prostate cancer
    100431578
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100431578
   05012 Parkinson disease
    100431578
   05014 Amyotrophic lateral sclerosis
    100431578
   05020 Prion disease
    100431578
   05022 Pathways of neurodegeneration - multiple diseases
    100431578
  09165 Substance dependence
   05030 Cocaine addiction
    100431578
   05031 Amphetamine addiction
    100431578
   05034 Alcoholism
    100431578
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100431578
   04934 Cushing syndrome
    100431578
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100431578
   05161 Hepatitis B
    100431578
   05163 Human cytomegalovirus infection
    100431578
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100431578
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 Med10 Fez1 AAA_13
Other DBs
NCBI-GeneID: 100431578
NCBI-ProteinID: XP_009248452
LinkDB
Position
15
AA seq 267 aa
MLEKMDLKEFDFDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKEPPQTVNPMGHL
PESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFRLELGSEVDITEGDRRPDSTAYIAMI
PQCKKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSACPKPYDPP
GEKMVAAKVKGEKLDKKLKKMEQNKTAATRYSKKKRAEQEALTGECKELEKKNEALKERA
DSLAKEIQYPKDLIEEVRKARGKKRVP
NT seq 804 nt   +upstreamnt  +downstreamnt
atgttggagaaaatggatttgaaggagttcgactttgatgccctgttgggtatagatgac
ctggaaaccatgccagatgaccttttgaccacgttggatgacacctgtgatctctttgcc
cctctagtccaggagactaataaggagcccccccagacggtgaacccaatgggccatctc
ccagaaagtttaacaaaacctgaccaggttgcccccttcaccttcttgcaacctcttccc
ctttccccaggggtcctgtcctccactccagatcattcctttcgtttagaactgggcagt
gaagtggatatcactgaaggagataggaggccagactccactgcttacattgccatgatc
cctcagtgcaaaaaggaggaagacaccccttcagataatgatagtggcatctgtatgagc
ccagagtcctatctggggtctcctcagcatagcccctctaccaggggctctccaaatagg
agcctcccatctccaggtgttctctgtgggtctgcctgccccaaaccttacgatcctcct
ggagagaagatggtagcagcaaaagtaaagggtgagaaactggataagaagctgaaaaaa
atggagcaaaacaagacagcagccactaggtacagcaagaagaagagggcggagcaggag
gctctcactggcgagtgcaaagagctggaaaagaagaacgaggctctaaaagagagggcg
gattccctggccaaggagatccagtacccgaaagatttgatagaagaggtccgcaaggca
agggggaagaaaagggtcccctag

KEGG   Pongo abelii (Sumatran orangutan): 100432292
Entry
100432292         CDS       T01416                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04714  Thermogenesis
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04931  Insulin resistance
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon05016  Huntington disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100432292 (CREB3L1)
   04024 cAMP signaling pathway
    100432292 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    100432292 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    100432292 (CREB3L1)
   04152 AMPK signaling pathway
    100432292 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100432292 (CREB3L1)
   04922 Glucagon signaling pathway
    100432292 (CREB3L1)
   04915 Estrogen signaling pathway
    100432292 (CREB3L1)
   04926 Relaxin signaling pathway
    100432292 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    100432292 (CREB3L1)
   04918 Thyroid hormone synthesis
    100432292 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    100432292 (CREB3L1)
   04916 Melanogenesis
    100432292 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    100432292 (CREB3L1)
   04927 Cortisol synthesis and secretion
    100432292 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100432292 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100432292 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    100432292 (CREB3L1)
   04728 Dopaminergic synapse
    100432292 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    100432292 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100432292 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100432292 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100432292 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100432292 (CREB3L1)
   05020 Prion disease
    100432292 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    100432292 (CREB3L1)
   05031 Amphetamine addiction
    100432292 (CREB3L1)
   05034 Alcoholism
    100432292 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100432292 (CREB3L1)
   04934 Cushing syndrome
    100432292 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100432292 (CREB3L1)
   05161 Hepatitis B
    100432292 (CREB3L1)
   05163 Human cytomegalovirus infection
    100432292 (CREB3L1)
   05165 Human papillomavirus infection
    100432292 (CREB3L1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100432292 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 100432292
NCBI-ProteinID: XP_024110597
Ensembl: ENSPPYG00000003324
LinkDB
Position
11
AA seq 519 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPSAMAAVAAMATTPLLGLSTLSRLPIPHQAPGEMTQL
PVIKAEPPEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMAADSVYTASQM
PSRSLLFYDDGAGSWEDGRSALLPMEPPDGWEINPGGPAEQRPQDHLQHDHLDSTHETTK
YLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggaacccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggacttcctcaacaatgcgcactttcctgagcacctg
gaccacttcacggagaacatggaggacttctccaatgacctgttcagcagcttctttgat
gaccctgtgctggatgagaagagccctctattggacatggaactggactcccctacgcca
ggcatccaagcagagcacagctactccctgagtggcgactcagctccccagagccccctt
gtgcccatcaagatggaggacaccacccaagacgcagagcatggagcgtgggcactggga
cacaaactgtgctccatcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgccccctcggccatggctgctgtggccgccatggccaccaccccgctgctgggc
ctcagcactttgtccaggctgcccatcccccaccaggcaccgggagagatgactcagctg
ccagtgatcaaagcagagcctccggaggtgaaccagttcctcaaagtgacaccggaggac
cttgtgcagatgcctccgacgccccccagcagccatggcagcgacagcgacggctcccag
agtccccgctctctgcccccctccagccctgtcaggcccatggcgcgctcctccacggcc
atctccacctccccactcctcactgcccctcacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaagcggaccctgattgctgagggctaccccatccccacaaaa
ctccccctcaccaaagccgaggagaaggccttgaagagagtccggaggaaaatcaagaat
aagatctcggcccaggaaagccgtcgtaagaagaaggagtatgtggagtgtctagaaaag
aaggtggagacatttacatctgagaacaatgaactgtggaagaaggtggagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ttgtgctttgttctggtgctgggctccctcgtgccctgccttcctgagttctcctctggc
tcccagactgtgaaggaagaccccatggccgcagacagcgtctacacggccagccagatg
ccctcccggagcctcctattctacgatgacggggcaggctcatgggaagatggccgcagc
gccctgctgcccatggagcccccagatggctgggaaatcaaccccggggggccagcagag
cagcggccccaggaccacctgcagcatgatcacctggacagcacccacgagaccaccaag
tacctgagtgaggcctggcctaaagacggtggaaacggcaccagccccgacttctcccac
tccaaagagtggttccacgacagggatctgggccccaacaccaccatcaaactctcctag

KEGG   Pongo abelii (Sumatran orangutan): 100436186
Entry
100436186         CDS       T01416                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04714  Thermogenesis
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04931  Insulin resistance
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon05016  Huntington disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100436186 (CREB3L4)
   04024 cAMP signaling pathway
    100436186 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    100436186 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    100436186 (CREB3L4)
   04152 AMPK signaling pathway
    100436186 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100436186 (CREB3L4)
   04922 Glucagon signaling pathway
    100436186 (CREB3L4)
   04915 Estrogen signaling pathway
    100436186 (CREB3L4)
   04926 Relaxin signaling pathway
    100436186 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    100436186 (CREB3L4)
   04918 Thyroid hormone synthesis
    100436186 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    100436186 (CREB3L4)
   04916 Melanogenesis
    100436186 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    100436186 (CREB3L4)
   04927 Cortisol synthesis and secretion
    100436186 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100436186 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100436186 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    100436186 (CREB3L4)
   04728 Dopaminergic synapse
    100436186 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    100436186 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    100436186 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100436186 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100436186 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100436186 (CREB3L4)
   05020 Prion disease
    100436186 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    100436186 (CREB3L4)
   05031 Amphetamine addiction
    100436186 (CREB3L4)
   05034 Alcoholism
    100436186 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100436186 (CREB3L4)
   04934 Cushing syndrome
    100436186 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100436186 (CREB3L4)
   05161 Hepatitis B
    100436186 (CREB3L4)
   05163 Human cytomegalovirus infection
    100436186 (CREB3L4)
   05165 Human papillomavirus infection
    100436186 (CREB3L4)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100436186 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 EMP24_GP25L JMY ATG16 HAUS-augmin3 UPF0242 HALZ KASH_CCD DUF1664 Jnk-SapK_ap_N MCU YabA DUF4200 DUF724
Other DBs
NCBI-GeneID: 100436186
NCBI-ProteinID: XP_002810170
Ensembl: ENSPPYG00000000792
UniProt: A0A2J8VFS9
LinkDB
Position
1
AA seq 395 aa
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVIRLQEQGLQGWKSGGDRGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCRPDSPPAPRTTSSPTLYEVVYEAG
ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCAT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
LLFSLALIILPSFNPFQSRPEAGPEDYQPHGVTSRNILTHKDITENLETQVVESRLKEPP
GAKDANGSTRTRLEKMGGKSRPSGRIRTVLHADEM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatctcggaatccctgacctgctggacgcgtggctggagcccccagaggatatcttc
tcgacaggatccgtcctggagctgggactccactgcccccctccagaggttccggtaatt
aggctacaggaacagggactgcaaggctggaagtccggtggggaccgtggctgtggcctt
caagagagtgagcctgaagatttcttgaagcttttcattgatcccaatgaggtgtactgc
tcagaagcatctcctggcagtgacagtggcatctctgaggacccctgccgtccagacagt
ccccctgcccccaggacaaccagttctcctacgctctatgaggttgtctatgaggcaggg
gccctggagaggatgcagggggaaactgggccaaatgtaggcctcatctccatccagcta
gatcagtggagcccagcatttatggtgcctgattcctgcatggtcagtgagctgcccttt
gatgctcatgcccacatcctgcccagagcaggcactgtagccccagtgccctgtgcaacc
ctgctgccctgtcaaaccctgttcctgaccgatgaggagaagcgtctgctggggcaggaa
ggggtttctctgccctctcacctgcctctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtcagctcaggacagtcggcggcggaagaaggag
tacattgatgggctggagagcagggtggcagcctgttctgcacagaaccaagaattacag
aaaaaagtccaggagctggagaggcacaacatctccttggtagctcagctccgccagctg
cagacgctaattgctcaaacttccaacaaagctgcccagaccagcacttgtgttttgatt
cttcttttttccctggctctcatcatcctgcccagcttcaatccattccagagtcgacca
gaagctgggcctgaggattaccagcctcacggagtgacttccagaaatatcctgacccac
aaggacataacagaaaatctggagacccaagtggtagagtccagactgaaggagccacct
ggagccaaggatgcaaatggctcaacaaggacacggcttgagaagatgggagggaagtca
agacccagtgggcgcatccggaccgtgctgcatgcggatgagatgtga

KEGG   Pongo abelii (Sumatran orangutan): 100438869
Entry
100438869         CDS       T01416                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04714  Thermogenesis
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04931  Insulin resistance
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon05016  Huntington disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100438869 (CREB3)
   04024 cAMP signaling pathway
    100438869 (CREB3)
   04022 cGMP-PKG signaling pathway
    100438869 (CREB3)
   04151 PI3K-Akt signaling pathway
    100438869 (CREB3)
   04152 AMPK signaling pathway
    100438869 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100438869 (CREB3)
   04922 Glucagon signaling pathway
    100438869 (CREB3)
   04915 Estrogen signaling pathway
    100438869 (CREB3)
   04926 Relaxin signaling pathway
    100438869 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    100438869 (CREB3)
   04918 Thyroid hormone synthesis
    100438869 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100438869 (CREB3)
   04916 Melanogenesis
    100438869 (CREB3)
   04925 Aldosterone synthesis and secretion
    100438869 (CREB3)
   04927 Cortisol synthesis and secretion
    100438869 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100438869 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100438869 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    100438869 (CREB3)
   04728 Dopaminergic synapse
    100438869 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    100438869 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100438869 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100438869 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100438869 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100438869 (CREB3)
   05020 Prion disease
    100438869 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    100438869 (CREB3)
   05031 Amphetamine addiction
    100438869 (CREB3)
   05034 Alcoholism
    100438869 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100438869 (CREB3)
   04934 Cushing syndrome
    100438869 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100438869 (CREB3)
   05161 Hepatitis B
    100438869 (CREB3)
   05163 Human cytomegalovirus infection
    100438869 (CREB3)
   05165 Human papillomavirus infection
    100438869 (CREB3)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100438869 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LptF_LptG JMY
Other DBs
NCBI-GeneID: 100438869
NCBI-ProteinID: XP_002819685
Ensembl: ENSPPYG00000019087
UniProt: A0A6D2WEP0 H2PRS4
LinkDB
Position
9
AA seq 371 aa
MELELDAGDQDLLGFLLEESGDLGTAPDEAVRAPLDWELPLSEVPSDWEVDDLLCSLLSP
PASLNILSSSNPCLVHHDHTYSLPREPASMDLENESCRKEGTQMTPQHMEELAEQEIARL
VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
RVLKYTAQNMELQNKVQLLEQQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
LLIPAMYSSDTRGSLPAEYGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
VLQAPGNSSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRDPIFPLQANLTRKGGWLPTGS
PSVILQDRYSG
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggagctggaattggatgctggtgaccaagacctgctgggcttcctgctagaggaaagt
ggagatttagggacggcacctgatgaggccgtgagggccccactggactgggagctgccg
ctttctgaggtaccgagcgactgggaagtagatgatttgctgtgctccctactgagtccc
ccagcgtcgttgaacattctcagctcctccaacccctgccttgtccaccatgaccacacc
tactccctcccacgggaacctgcctctatggatctagagaatgagagctgtagaaaagag
gggacccagatgactccacagcatatggaggagctggcagagcaggagattgctaggctg
gtactgacagatgaggagaagagtctattggagaaggaggggcttattctgcctgagaca
cttcctctcactaagacagaggaacaaattctgaaacgtgtgcggaggaagattcgaaat
aaaagatctgctcaagagagccgcaggaaaaagaaggtgtatgttgggggtttagagagc
agggtcttgaaatacacagcccagaatatggagcttcagaacaaagtacagcttctggag
caacagaatttgtcccttctagatcaactgaggaaactccaggccatggtgattgagata
tcaaacaaaaccagcagcagcagcacctgcatcttggtcctactagtctccttctgcctc
ctccttatacctgctatgtactcctctgacacacgggggagcctgccagctgagtatgga
gtgttgtcccgccagcttcgtgccctccccagtgaggacccttaccagctggagctgcct
gccctgcagtcagaggtgccaaaagacagcacacaccagtggttggacggctcagactgt
gtactccaggcccctggcaactcttcctgcctgctgcactacatgcctcaggctcccagt
gcagagcctcccctggagtggccattccctgacctcttctcagagcctctctgccgagat
cccatcttccccctgcaggcaaatctcacaaggaaggggggatggcttcctactggtagc
ccctctgtcattttgcaggacagatactcaggctag

KEGG   Pongo abelii (Sumatran orangutan): 100439720
Entry
100439720         CDS       T01416                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04714  Thermogenesis
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04915  Estrogen signaling pathway
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04931  Insulin resistance
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon05016  Huntington disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100439720 (CREB5)
   04024 cAMP signaling pathway
    100439720 (CREB5)
   04022 cGMP-PKG signaling pathway
    100439720 (CREB5)
   04151 PI3K-Akt signaling pathway
    100439720 (CREB5)
   04152 AMPK signaling pathway
    100439720 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100439720 (CREB5)
   04922 Glucagon signaling pathway
    100439720 (CREB5)
   04915 Estrogen signaling pathway
    100439720 (CREB5)
   04926 Relaxin signaling pathway
    100439720 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    100439720 (CREB5)
   04918 Thyroid hormone synthesis
    100439720 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    100439720 (CREB5)
   04925 Aldosterone synthesis and secretion
    100439720 (CREB5)
   04927 Cortisol synthesis and secretion
    100439720 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100439720 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100439720 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    100439720 (CREB5)
   04728 Dopaminergic synapse
    100439720 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    100439720 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    100439720 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100439720 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    100439720 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100439720 (CREB5)
   05020 Prion disease
    100439720 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    100439720 (CREB5)
   05031 Amphetamine addiction
    100439720 (CREB5)
   05034 Alcoholism
    100439720 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100439720 (CREB5)
   04934 Cushing syndrome
    100439720 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100439720 (CREB5)
   05161 Hepatitis B
    100439720 (CREB5)
   05163 Human cytomegalovirus infection
    100439720 (CREB5)
   05165 Human papillomavirus infection
    100439720 (CREB5)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100439720 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 Cnn_1N DivIC
Other DBs
NCBI-GeneID: 100439720
NCBI-ProteinID: XP_009241203
UniProt: A0A2J8VDP0
LinkDB
Position
7
AA seq 369 aa
MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPME
RQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMM
EMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSH
LHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRR
KFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHK
DCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTT
HRTDLNPIL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttctgcacctcaggagggaattcagcctcagtgatgtccatgaggcctgtcccaggc
tctctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatg
cctgggaccctgcccaaccctacaatgccaggatcttctgccgtcttgatgccaatggag
agacaaatgtcagtgaactccagcatcatggggatgcaaggtccaaacctcagcaacccc
tgtgcttctccccaggtccaaccaatgcattcagaggccaaaatgaggttgaaggctgca
ttgactcaccaccctgctgccatgtcaaatgggaacatgaacaccatgggacacatgatg
gagatgatgggctcccggcaggaccagacgccacaccatcacatgcactcgcacccgcat
cagcaccagacactgccaccccatcacccttacccacaccagcaccagcacccagcgcac
catcctcaccctcaaccccatcaccagcagaaccatccacatcaccactcccattcccac
cttcatgcacacccagcacatcaccagacctcgccacatccgcccctgcacaccggcaac
caagcacaggtttcaccagcaacacaacagatgcagccaacccagacaatacagccaccc
cagcccacaggggggcgccggcgaagggtggtagatgaggatccggacgagaggcggcgg
aaatttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgg
gtgatgtcattggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaat
gaagtgtctatgttgaaaaatgaggtggcccagctgaaacagttgttgttaacacataaa
gactgcccaataacagccatgcagaaagaatcacaaggatatctaagtccggagagtagc
cctcctgctagtcctgtcccggcttgctcccagcaacaagtcatccagcataataccatc
actacttcctcatcggtcagcgaggtggtaggaagctccaccctcagccagctcaccact
cacagaacagacctgaatccgattctttaa

KEGG   Pongo abelii (Sumatran orangutan): 100441756
Entry
100441756         CDS       T01416                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04714  Thermogenesis
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04931  Insulin resistance
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon05016  Huntington disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100441756 (CREB3L3)
   04024 cAMP signaling pathway
    100441756 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    100441756 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    100441756 (CREB3L3)
   04152 AMPK signaling pathway
    100441756 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100441756 (CREB3L3)
   04922 Glucagon signaling pathway
    100441756 (CREB3L3)
   04915 Estrogen signaling pathway
    100441756 (CREB3L3)
   04926 Relaxin signaling pathway
    100441756 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    100441756 (CREB3L3)
   04918 Thyroid hormone synthesis
    100441756 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    100441756 (CREB3L3)
   04916 Melanogenesis
    100441756 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    100441756 (CREB3L3)
   04927 Cortisol synthesis and secretion
    100441756 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100441756 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100441756 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    100441756 (CREB3L3)
   04728 Dopaminergic synapse
    100441756 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    100441756 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100441756 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100441756 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100441756 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100441756 (CREB3L3)
   05020 Prion disease
    100441756 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    100441756 (CREB3L3)
   05031 Amphetamine addiction
    100441756 (CREB3L3)
   05034 Alcoholism
    100441756 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100441756 (CREB3L3)
   04934 Cushing syndrome
    100441756 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100441756 (CREB3L3)
   05161 Hepatitis B
    100441756 (CREB3L3)
   05163 Human cytomegalovirus infection
    100441756 (CREB3L3)
   05165 Human papillomavirus infection
    100441756 (CREB3L3)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100441756 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 ZapB
Other DBs
NCBI-GeneID: 100441756
NCBI-ProteinID: XP_024093313
LinkDB
Position
19
AA seq 461 aa
MNTDLAAGKMASTACPMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDS
DNFLSSILGSGDSQPSSPLWSPEGSDSGISEDLPSDPQDTPPHSGPATSPTGCHPAQPSE
GPCLSYHPGNSCPTTPPGPVIQVPEASVTIDLEMWSPGGRIYAEKRADPVDLSPRCNLTV
KDLLLSGGSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLSKYE
ERVLKKVRRKIRNKQSAQESRKKKKEYIDSLETRMSACTAQNQELQRKVLHLEKQNLSLL
EQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKAESPGDFAPVRVFS
RTLHNDAASRVAADAVLGSEAPGPRPEADTTREESPGSPGADWGFQNTANLTNSTEELDN
ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEATGDEL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaatacggatttagctgctggaaagatggcttctactgcctgccccatggaccccatc
gacagctttgagctcctggatctcctgtttgaccggcaggacggcatcctgagacacgtg
gagctgggcgagggctggggccacgtgaaggaccagcaggtcctgccaaaccccgactct
gacaacttcctcagctccatcctgggctctggagactcacagcccagctccccactctgg
tcccccgaaggcagtgatagtggcatctccgaagacctcccctccgacccccaggacacc
cctccacacagcggaccggccacctcccccaccggctgccatcctgcccagcccagcgag
gggccctgcctctcctatcatcctggcaactcttgccccaccacacccccagggccagtg
atccaagtgcctgaagcctctgtgaccatagacctggaaatgtggagcccaggaggaagg
atctatgctgagaagagggctgatccggtggacctgtccccacgatgcaatctcaccgtg
aaagacctcctcctttcgggcggcagcggggacctgcaacagcatcacctgggggcctcc
tacctcctgcgacctggcgctgggcactgtcaggagctggtgctcaccgaggatgagaag
aagctgctggctaaagaaggcatcaccctgcccactcagctgcccctcagtaagtacgag
gagcgagtgctgaaaaaagtccgccggaaaatccggaacaagcagtcggcccaagaaagc
aggaagaagaagaaggaatatatcgacagcctggagactcggatgtcagcttgcactgct
cagaatcaggagttacaaagaaaagtcttgcatctcgagaagcaaaacctgtccctcttg
gagcagctgaagaaactccaggccattgtggtgcagtccaccagcaagtcagcccagacg
ggcacctgtgttgcggtcctgttgctgtcctttgccctcatcatcctcccctccatcagc
ccttttggccccaacaaagccgagagccctggggactttgcgcctgtgcgagtgttctcc
agaactttgcacaacgatgctgcctcccgcgtggccgctgatgctgtgctgggctccgag
gccccaggcccccgacccgaggctgacacaacccgagaagagtctccaggaagccccggg
gcagactggggcttccagaacaccgcgaacctgaccaattcgacggaggagctggacaac
gccaccctggtcctgaggaatgcaacagaggggctgggccaggtcgccctgctggattgg
gtggcgcctgggccgagcactggctcaggacgtgcagggctggaggcgacgggagatgag
ctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100462459
Entry
100462459         CDS       T01416                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04137  Mitophagy - animal
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04918  Thyroid hormone synthesis
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04932  Non-alcoholic fatty liver disease
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100462459 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100462459 (ATF4)
   04668 TNF signaling pathway
    100462459 (ATF4)
   04022 cGMP-PKG signaling pathway
    100462459 (ATF4)
   04151 PI3K-Akt signaling pathway
    100462459 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100462459 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    100462459 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100462459 (ATF4)
   04922 Glucagon signaling pathway
    100462459 (ATF4)
   04912 GnRH signaling pathway
    100462459 (ATF4)
   04915 Estrogen signaling pathway
    100462459 (ATF4)
   04926 Relaxin signaling pathway
    100462459 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    100462459 (ATF4)
   04918 Thyroid hormone synthesis
    100462459 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    100462459 (ATF4)
   04925 Aldosterone synthesis and secretion
    100462459 (ATF4)
   04927 Cortisol synthesis and secretion
    100462459 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100462459 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    100462459 (ATF4)
   04728 Dopaminergic synapse
    100462459 (ATF4)
   04720 Long-term potentiation
    100462459 (ATF4)
   04722 Neurotrophin signaling pathway
    100462459 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    100462459 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100462459 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100462459 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100462459 (ATF4)
   05012 Parkinson disease
    100462459 (ATF4)
   05014 Amyotrophic lateral sclerosis
    100462459 (ATF4)
   05020 Prion disease
    100462459 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    100462459 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    100462459 (ATF4)
   05031 Amphetamine addiction
    100462459 (ATF4)
   05034 Alcoholism
    100462459 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100462459 (ATF4)
   04934 Cushing syndrome
    100462459 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100462459 (ATF4)
   05161 Hepatitis B
    100462459 (ATF4)
   05163 Human cytomegalovirus infection
    100462459 (ATF4)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100462459 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4795 DUF4407 Fez1 Laminin_II Nop53 AAA_13 bZIP_Maf
Other DBs
NCBI-GeneID: 100462459
NCBI-ProteinID: XP_009232671
Ensembl: ENSPPYG00000011842
UniProt: H2P4G1
LinkDB
Position
22
AA seq 352 aa
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDFDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKEPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPVSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDSTAYVITMIPHCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTR
GSPNRSLPSPGVLCGSGRPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKK
RAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaccgaaatgagcttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcttaggtctcttagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtccctccaacaacagcaaggaggatgccttctcc
gggacagattggatgttggagaaaatggatttgaaggagttcgactttgatgccctgttg
ggtatagatgatctggaaaccatgccagatgaccttttgaccacgttggatgacacttgt
gatctctttgcccctctagtccaggagactaataaggagcccccccagacagtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccccttcaccttcttg
caacctcttcccgtttccccaggggtcctgtcctccactccagatcattcctttagttta
gagctgggcagtgaagtggatatcactgaaggagataggaagccagactccactgcttat
gttattaccatgatccctcattgcataaaggaggaagacaccccttcagataatgatagt
ggcatctgtatgagcccagagtcctatctggggtctcctcagcatagcccctctaccagg
ggctctccaaataggagcctcccatctccaggtgttctctgtgggtctgggcgccccaaa
ccttacgatcctcctggagagaagatggtagcagcaaaagtaaagggtgagaagctggat
aagaagctgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaag
agggcggagcaggaggctctcactggagagtgtaaagagctggaaaagaagaacgaggct
ctaaaagagagggcggattccctggccaaggagatccagtacctgaaagatttgatagaa
gaggtccgcaaggcaagggggaagaaaagggtcccctag

DBGET integrated database retrieval system