Pongo abelii (Sumatran orangutan): 100137027 Help Entry 100137027         CDS       T01416                                  Symbol CAV1 Name (RefSeq) caveolin-1   KO K06278   caveolin 1 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04144   Endocytosis pon04510   Focal adhesion pon05020   Prion disease pon05100   Bacterial invasion of epithelial cells pon05205   Proteoglycans in cancer pon05416   Viral myocarditis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100137027 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100137027 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100137027 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100137027 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     100137027 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100137027 (CAV1)    05416 Viral myocarditis     100137027 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100137027 (CAV1) Membrane trafficking [BR:pon04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     100137027 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  100137027 NCBI-ProteinID:  NP_001162005 Ensembl:  ENSPPYG00000017931 UniProt:  Q2IBD7 A0A2J8UPG7 LinkDB All DBs Position 6:113646021..113684400 Genome browser AA seq 178 aa AA seqDB search MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEELSEKQVYDAHTKEIDLVNRDPKHLN DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtctgggggcaaatacgtagactcggagggacatctctacaccgttcccatccgggaa cagggcaacatctacaagcccaacaacaaggccatggcagaggagctgagcgagaagcaa gtgtacgacgcgcacaccaaggagatcgacctggtcaaccgcgaccctaaacacctcaac gatgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt ttcgatggcatttggaaagccagcttcaccaccttcactgtgacgaaatactggttttac cgcttgctgtctgccctctttggcatcccaatggcgctcatctggggcatttactttgcc attctctctttcctgcacatctgggcagttgtaccatgcattaagagcttcctgattgag attcagtgcatcagccgtgtctattccatctacgtccacaccgtctgtgacccactcttt gaagctgttgggaaaatattcagcaatgtccgcatcaacttgcagaaagaaatataa

Pongo abelii (Sumatran orangutan): 100137028 Help Entry 100137028         CDS       T01416                                  Symbol CAV2 Name (RefSeq) caveolin-2   KO K12958   caveolin 2 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04144   Endocytosis pon04510   Focal adhesion pon05020   Prion disease pon05100   Bacterial invasion of epithelial cells pon05205   Proteoglycans in cancer pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100137028 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100137028 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100137028 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100137028 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     100137028 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100137028 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100137028 (CAV2) Membrane trafficking [BR:pon04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     100137028 (CAV2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  100137028 NCBI-ProteinID:  NP_001162006 Ensembl:  ENSPPYG00000017930 UniProt:  Q2IBD6 A0A2J8UPI9 LinkDB All DBs Position 6:113622703..113631890 Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVIAEP VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRSFSSVSLQLSQD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagacggagaaggcggacgtgcagctcttcatggacgacgactcctacagc caccacagcggcctcgagtacgccgaccccgagaagttcgcggactcgggccaggaccgg gatccccaccggctcaactcgcatctcaagctgggcttcgaggatgtgatcgcagagccg gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc aaatacgtaatgtacaagttcctgacggtgttcctggccattcccctggccttcattgcg ggaattctctttgccaccctcagctgtctgcacatctggattttaatgccttttgtaaag acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttatc attgctccattgtgtacgagcgtaggacgaagcttctcttctgtcagcctgcaactgagc caggactga

Pongo abelii (Sumatran orangutan): 100440174 Help Entry 100440174         CDS       T01416                                  Symbol CAV3 Name (RefSeq) caveolin-3 isoform X1   KO K12959   caveolin 3 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04144   Endocytosis pon04510   Focal adhesion pon05020   Prion disease pon05100   Bacterial invasion of epithelial cells pon05205   Proteoglycans in cancer pon05410   Hypertrophic cardiomyopathy pon05412   Arrhythmogenic right ventricular cardiomyopathy pon05414   Dilated cardiomyopathy pon05416   Viral myocarditis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100440174 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100440174 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100440174 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100440174 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     100440174 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100440174 (CAV3)    05410 Hypertrophic cardiomyopathy     100440174 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     100440174 (CAV3)    05414 Dilated cardiomyopathy     100440174 (CAV3)    05416 Viral myocarditis     100440174 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100440174 (CAV3) Membrane trafficking [BR:pon04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     100440174 (CAV3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  100440174 NCBI-ProteinID:  XP_054407834 LinkDB All DBs Position 2:complement(70043287..70055730) Genome browser AA seq 154 aa AA seqDB search MIESSLRPHQKPSRCQHHASCTDHRPMGQLNLLSLSITQPQVDFEDVIAEPVGTYSFDGV WKVSYTTFTVSKYWCYRLLSTLLGIPLALFWGFLFACISFCHIWAVVPCIKSYLIEIQCI SHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgattgaaagctccctgaggcctcaccagaagccaagcagatgccagcaccatgcttcc tgcacagatcacagacctatgggccaattaaacctcctttctttatcaattacccagcct caggtggatttcgaagacgtgatcgcagagcccgtgggcacctacagctttgacggcgtg tggaaggtgagctacaccaccttcaccgtctccaagtactggtgctaccgcctgttgtcc acactgctgggcatcccactggccctgttttggggcttcctgttcgcctgcatctccttc tgccacatctgggcggtggtgccgtgcattaagagctacctgatcgagatccagtgcatc agccacatctactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggc caagtctgcagcagcatcaaggtggtgctgcggaaggaggtctaa

DBGET integrated database retrieval system