KEGG   Pongo abelii (Sumatran orangutan): 100137027
Entry
100137027         CDS       T01416                                 

Gene name
CAV1
Definition
(RefSeq) caveolin-1
  KO
K06278  caveolin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04510  Focal adhesion
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05205  Proteoglycans in cancer
pon05416  Viral myocarditis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100137027 (CAV1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100137027 (CAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100137027 (CAV1)
  09164 Neurodegenerative disease
   05020 Prion disease
    100137027 (CAV1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100137027 (CAV1)
   05416 Viral myocarditis
    100137027 (CAV1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100137027 (CAV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100137027 (CAV1)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100137027 (CAV1)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 100137027
NCBI-ProteinID: NP_001162005
Ensembl: ENSPPYG00000017931
UniProt: Q2IBD7 A0A2J8UPG7
LinkDB
Position
7
AA seq 178 aa
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactcggagggacatctctacaccgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatggcagaggagctgagcgagaagcaa
gtgtacgacgcgcacaccaaggagatcgacctggtcaaccgcgaccctaaacacctcaac
gatgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt
ttcgatggcatttggaaagccagcttcaccaccttcactgtgacgaaatactggttttac
cgcttgctgtctgccctctttggcatcccaatggcgctcatctggggcatttactttgcc
attctctctttcctgcacatctgggcagttgtaccatgcattaagagcttcctgattgag
attcagtgcatcagccgtgtctattccatctacgtccacaccgtctgtgacccactcttt
gaagctgttgggaaaatattcagcaatgtccgcatcaacttgcagaaagaaatataa

KEGG   Pongo abelii (Sumatran orangutan): 100137028
Entry
100137028         CDS       T01416                                 

Gene name
CAV2
Definition
(RefSeq) caveolin-2
  KO
K12958  caveolin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04510  Focal adhesion
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05205  Proteoglycans in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100137028 (CAV2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100137028 (CAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100137028 (CAV2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100137028 (CAV2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100137028 (CAV2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100137028 (CAV2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100137028 (CAV2)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100137028 (CAV2)
SSDB
Motif
Pfam: Caveolin SPC12
Other DBs
NCBI-GeneID: 100137028
NCBI-ProteinID: NP_001162006
Ensembl: ENSPPYG00000017930
UniProt: Q2IBD6 A0A2J8UPI9
LinkDB
Position
7
AA seq 162 aa
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRSFSSVSLQLSQD
NT seq 489 nt   +upstreamnt  +downstreamnt
atggggctggagacggagaaggcggacgtgcagctcttcatggacgacgactcctacagc
caccacagcggcctcgagtacgccgaccccgagaagttcgcggactcgggccaggaccgg
gatccccaccggctcaactcgcatctcaagctgggcttcgaggatgtgatcgcagagccg
gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc
aaatacgtaatgtacaagttcctgacggtgttcctggccattcccctggccttcattgcg
ggaattctctttgccaccctcagctgtctgcacatctggattttaatgccttttgtaaag
acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttatc
attgctccattgtgtacgagcgtaggacgaagcttctcttctgtcagcctgcaactgagc
caggactga

KEGG   Pongo abelii (Sumatran orangutan): 100440174
Entry
100440174         CDS       T01416                                 

Gene name
CAV3
Definition
(RefSeq) caveolin-3
  KO
K12959  caveolin 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04510  Focal adhesion
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05205  Proteoglycans in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100440174 (CAV3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100440174 (CAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100440174 (CAV3)
  09164 Neurodegenerative disease
   05020 Prion disease
    100440174 (CAV3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100440174 (CAV3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100440174 (CAV3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100440174 (CAV3)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100440174 (CAV3)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 100440174
NCBI-ProteinID: XP_002813532
UniProt: A0A2J8WDX6
LinkDB
Position
3
AA seq 151 aa
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGIPLALFWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
NT seq 456 nt   +upstreamnt  +downstreamnt
atgatggcagaagagcacacagacctcgaggcccagatcgtcaaggatatccactgcaag
gagattgacctggtgaatcgagaccccaagaacattaatgaagacatagtcaaggtggat
ttcgaagacgtgatcgcagagcccgtgggcacctacagctttgacggcgtgtggaaggtg
agctacaccaccttcaccgtctccaagtactggtgctaccgcctgttgtccacactgctg
ggcatcccactggccctgttttggggcttcctgttcgcctgcatctccttctgccacatc
tgggcggtggtgccgtgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggccaagtctgc
agcagcatcaaggtggtgctgcggaaggaggtctaa

DBGET integrated database retrieval system