KEGG   Pongo abelii (Sumatran orangutan): 100147742
Entry
100147742         CDS       T01416                                 

Gene name
TSC1
Definition
(RefSeq) hamartin
  KO
K07206  tuberous sclerosis 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04218  Cellular senescence
pon04714  Thermogenesis
pon04910  Insulin signaling pathway
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05168  Herpes simplex virus 1 infection
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100147742 (TSC1)
   04151 PI3K-Akt signaling pathway
    100147742 (TSC1)
   04152 AMPK signaling pathway
    100147742 (TSC1)
   04150 mTOR signaling pathway
    100147742 (TSC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100147742 (TSC1)
  09143 Cell growth and death
   04218 Cellular senescence
    100147742 (TSC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100147742 (TSC1)
  09149 Aging
   04211 Longevity regulating pathway
    100147742 (TSC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100147742 (TSC1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100147742 (TSC1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100147742 (TSC1)
   05163 Human cytomegalovirus infection
    100147742 (TSC1)
   05165 Human papillomavirus infection
    100147742 (TSC1)
SSDB
Motif
Pfam: Hamartin
Other DBs
NCBI-GeneID: 100147742
NCBI-ProteinID: NP_001124557
Ensembl: ENSPPYG00000019717
UniProt: Q5RER4
LinkDB
Position
9
AA seq 1164 aa
MAQQANVGELLAMLDSPMLGVRDDVTAVFKENLNSDRGPMLVNTLVDYYLETNSQPALHI
LTTLQEPHDKHLLDRINEYVGKAATRLSILSLLGHVIRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVVVLTTGVLVLITMLPMIPQSGKQHLLDFFDIFGRLSSWCLKKPGHVAEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSRDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQISARFPHRSADVTTSPYADT
QNSYGCATSTPYSTSRLTLLNTPGQLPQTLSSPSTRLITEPPQATFWSPSMVCGMTTPPT
SPGNVPPDLSHPYSKVFGTTAGGKGTPLGTPATSPPPAPLCHSDDYVHISLPQATVTPPR
KEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEA
AISRELSEITTAEAEPVVPRGGFDSPFYRDSLPGSQRKTHSAASSSQGASVNPEPLHSSL
DKLGPDTPKQAFTPIDLPCGSADESPAGDRECQTSLETSILTPSPCKIPPPTRVGFGSGQ
PPPYDHLFEVALPKTAHHFIIRKTEELLKKAKGNTEEDCVPSTSPMEVLDRLIQQGADAH
SKELNKLPLPSKSVDWTHFGGSPPSDEIRTLRDQLLLLHNQLLYERFKRQQHALRNRRLL
RKVIKAAALEEHNTAMKDQLKLQEKDIQMWKVSLQKEQARYSQLQEQRDTMVTKLHSQIR
QLQHDREEFYNQSQELQTKLEDCRNMIAELRIELKKANNKVCHTELLLSQVSQKLSNSES
VQQQMEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKAAYRKELEKNRSHVLQQTQ
RLDTSQKRILELESHLAKKDHLLLEQKKYLEDVKLQARGQLQAAESRYEAQKRITQVFEL
EILDLYGRLEKDGLLKKLEEEKAEAAEAAEERLDCCNDGCSDSMVGHNEEASGHNGETKT
PRPSSTRGSSGSRGGGGSSSSSSELSTPEKPPHQRAGPFSSRWETTMGEASASIPTTVGS
LPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELGKDLGVEAKIPLNLDGPHT
PPPNPDSVGQLHIMDYNETHHEHS
NT seq 3495 nt   +upstreamnt  +downstreamnt
atggcccaacaagcgaatgtcggggagcttcttgccatgctggactcccccatgctgggt
gtgcgggacgacgtgacagctgtctttaaagagaacctcaattctgaccgtggtcctatg
cttgtaaacaccttggtggattattacctggaaaccaactctcagccagcattgcacatc
ctgaccaccttgcaagagccacatgacaagcacctcttggacaggattaacgaatatgtg
ggcaaagctgccactcgtttatccatcctctcgttactgggtcatgtcataagactgcag
ccatcttggaagcataaactctctcaagcacctcttttgccttctttactaaaatgtctc
aagatggacactgatgtcgttgtcctcacaacaggcgtcttggtgttgataaccatgcta
ccaatgattccacagtctgggaaacagcatcttcttgatttctttgacatttttggccgt
ctatcatcatggtgcctgaagaaaccaggccacgtggcggaagtctatctcgtccatctc
catgccagtgtgtacgcactctttcatcgcctttatggaatgtacccttgcaacttcgtc
tcctttttgcgttctcattacagtatgaaagaaaacctggagacttttgaagaagtggtc
aagccaatgatggagcatgtgcgaattcatccggaattagtgactggatccagggaccat
gaactggaccctcgaaggtggaagagattagaaactcatgatgttgtgatcgagtgtgcc
aaaatctctctggatcccacagaagcctcatatgaagatggctattctgtgtctcaccaa
atctcagcccgctttcctcatcgttcagccgatgtcaccaccagcccttatgctgacaca
cagaatagctatgggtgtgctacttctaccccttactccacgtctcggctgacgttgtta
aatacgccagggcagctacctcagactctgagttccccatcgacacggctgataactgaa
ccaccacaagctactttttggagcccatctatggtttgtggtatgaccactcctccaact
tctcctggaaatgtcccacctgatctgtcacacccttacagtaaagtctttggtacaact
gcaggtggaaaaggaactcctctgggaaccccagcaacctctcctcctccagccccactc
tgtcattcggatgactacgtgcacatttcactcccccaggccacagtcacgccccccagg
aaggaagagagaatggattctgcaagaccatgtctacacagacaacaccatcttctgaat
gacagaggatcagaagagccacctggcagcaaaggttctgtcactctaagtgatcttcca
gggtttttaggtgatctggcctctgaagaagatagtatagaaaaagataaagaagaagct
gcaatatctagagaactttctgagatcaccacagcagaggcagagcctgtggttcctcga
ggaggctttgactctcccttttaccgagacagtctcccaggttctcagcggaagacccac
tcggcagcctccagttctcagggcgccagcgtgaaccctgagcctttacactcctccctg
gacaagcttgggcctgacacaccaaagcaagcctttactcccatagacctgccctgcggc
agtgctgatgaaagccctgcgggagacagggaatgccagacttctttggagaccagtatc
ctcactcccagtccttgtaaaattccacctccaacgagagtgggctttggaagcgggcag
cctcccccgtatgatcatctttttgaggtggcattgccaaagacagcccatcattttatc
atcaggaagactgaggagctgttaaagaaagcaaaaggaaacacagaggaagattgtgtg
ccctctacctccccaatggaagtgctggacagactgatacagcagggagcagacgcgcac
agcaaggagctgaacaagttgcctttacccagcaagtctgtcgactggacccactttgga
ggctctcctccttcagatgagatccgcaccctccgagaccagttgcttttactgcacaac
cagttactctatgagcgttttaagaggcagcagcatgccctccggaacaggcggctcctc
cgcaaggtgatcaaagcagcagctctggaggaacataataccgccatgaaagatcagttg
aagttacaagagaaggacatccagatgtggaaggttagtctgcagaaagaacaagctaga
tacagtcagcttcaggagcagcgtgacactatggtaaccaagctccacagccagatcaga
cagctgcagcatgaccgagaggaattctacaaccagagccaggaattacagacgaagctg
gaggactgcaggaacatgattgcagagctgcggatagaattgaagaaggccaacaacaag
gtgtgtcacactgagctgctgctcagtcaggtttcccaaaagctctcaaacagtgagtcg
gtccagcagcagatggagttcttgaacaggcagctgttggttcttggggaggtcaacgag
ctatatttggaacaactgcagaacaagcactcagataccacaaaggaagtagaaatgatg
aaagctgcctatcggaaagagctagaaaaaaacagaagccatgttctccagcagactcag
aggcttgatacctcccaaaaacggattttggaactggaatctcacctggccaagaaagac
caccttcttttggaacagaagaaatatctagaggatgtcaaactccaggcaagaggacag
ctgcaggccgcagagagcaggtatgaggctcagaaaaggataacccaggtgtttgaattg
gagatcttagatttatatggcaggttggagaaagatggcctcctgaaaaaacttgaagaa
gaaaaagcagaagcagctgaagcagcagaagaaaggcttgactgttgtaacgacgggtgc
tcagattccatggtagggcacaatgaagaggcatctggccacaacggtgagaccaagacc
cccaggcccagcagcacccggggcagtagtggaagcagaggaggtggaggcagcagcagc
agcagcagcgagctttctaccccagagaaacccccacaccagagggcaggcccattcagc
agtcggtgggagacgactatgggagaagcctctgccagcatccccaccactgtgggctca
cttcccagttcaaaaagcttcctgggtatgaaggctcgagagttatttcgtaataagagc
gagagccagtgtgatgaggacggcatgaccagtagcctttctgagagcctaaagacagaa
ctgggcaaagacttgggtgtggaagccaagattcccctgaatctagatggcccgcacaca
cctcccccgaacccggacagtgttggacagctacatatcatggactacaatgagactcat
catgaacacagctaa

DBGET integrated database retrieval system