KEGG   Pongo abelii (Sumatran orangutan): 100171409
Entry
100171409         CDS       T01416                                 

Gene name
WASL
Definition
(RefSeq) neural Wiskott-Aldrich syndrome protein
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04520  Adherens junction
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100171409 (WASL)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100171409 (WASL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100171409 (WASL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100171409 (WASL)
   05135 Yersinia infection
    100171409 (WASL)
   05100 Bacterial invasion of epithelial cells
    100171409 (WASL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100171409 (WASL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100171409 (WASL)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100171409 (WASL)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     100171409 (WASL)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 100171409
NCBI-ProteinID: NP_001128797
Ensembl: ENSPPYG00000017959
UniProt: A0A6D2XAS8 H2PND3 Q5RFT6
LinkDB
Position
7
AA seq 505 aa
MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPATAGNKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgagctccgtccagcagcagccgccgccgccgcggagggtcaccaacgtggggtccctg
ctgctcaccccgcaggagaacgagtccctcttcaccttcctcggcaagaaatgtgtgact
atgtcttcagcagtggtgcagttatatgcagcagatcgaaactgtatgtggtcaaagaag
tgcagtggtgttgcttgtcttgttaaggacaatccacagagatcttattttttaagaata
tttgacattaaggatgggaaactattgtgggaacaagagctatacaataactttgtatat
aatagtcctagaggatattttcatacctttgctggagatacttgtcaagttgctcttaat
tttgccaatgaagaagaagcaaaaaaatttcgaaaagcagttacagacctgttgggccgt
cgacaaaggaaatctgagaaaagacgagatcccccaaatggtcctaatctacccatggct
acagttgatataaaaaatccagaaatcacaacaaatagattttatggtccacaagtcaac
aacatctcccataccaaagaaaagaagaaaggaaaagctaaaaagaagagattaaccaag
gcggatataggaacaccaagcaatttccagcacattggacatgttggttgggatccaaat
acaggctttgatctgaataatttggatccagaattgaagaatcttttcgatatgtgtgga
atctcagaggcacaacttaaagacagagaaacatcaaaagttatatatgactttattgaa
aaaacaggaggtgttgaagctgttaaaaatgaactgcgaaggcaagcaccaccacctcca
ccaccatcaaggggagggccacctcctcctcctccccctccacacaactcaggtcctcct
cctcctcctgccaggggaagaggcgctcctcccccaccaccttcaagagctcccacagct
gcacctccaccaccgcctccttccaggccaagtgtagcagtccctccaccaccgccaaat
aggatgtaccctcctccacctccagcccttccctcctcagcaccttcagggcctccacca
ccacctccatctgtgttgggggtagggccagtggcaccacccccaccgcctccacctcca
cctcctcctgggccaccgcccccgcctggcctgccttctgatggggaccatcaggttcca
gctactgcaggaaacaaagcagctcttttagatcaaattagagagggtgctcagctaaaa
aaagtggagcagaacagtcggccagtgtcctgctctggacgagatgcactgttagaccag
atacgacagggtatccaactaaagtctgtgtctgatggccaagagtctacaccaccaaca
cccgcacccacttcaggaattgtgggtgcattaatggaagtgatgcagaaaaggagcaaa
gccattcattcttcagacgaagatgaagatgaagatgatgaagaagattttgaggatgat
gatgagtgggaagactga

DBGET integrated database retrieval system