KEGG   Pongo abelii (Sumatran orangutan): 100171490
Entry
100171490         CDS       T01416                                 

Gene name
AR
Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04114  Oocyte meiosis
pon05200  Pathways in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100171490 (AR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171490 (AR)
  09162 Cancer: specific types
   05215 Prostate cancer
    100171490 (AR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100171490 (AR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pon03310]
    100171490 (AR)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100171490 (AR)
Nuclear receptors [BR:pon03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100171490 (AR)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100171490
NCBI-ProteinID: NP_001124649
Ensembl: ENSPPYG00000020425
UniProt: Q5RFF5 A0A6D2WU82
LinkDB
Position
X
AA seq 388 aa
MILWLHSLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQ
KYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSP
TEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQ
LVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFN
EYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELR
MNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDF
PEMMAEIISVQVPKILSGKVKPIYFHTQ
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgatactctggcttcacagtttggagactgccagggaccatgttttgcccattgactat
tactttccaccccagaagacctgcctgatctgtggagacgaagcttctgggtgtcactat
ggagctctcacatgtggaagctgcaaggtcttcttcaaaagagccgctgaagggaaacag
aagtacctgtgtgccagcagaaatgattgcactattgataaattccgaaggaaaaattgt
ccatcttgtcgtcttcggaaatgttatgaagcagggatgactctgggagcccgaaagctg
aagaaacttggtaatctgaaactacaggaggaaggagaggcttccagcaccaccagcccc
actgaggagacaacccagaagctgacagtgtcacacattgaaggctatgaatgtcagccc
atctttctgaatgtcctggaagccattgagccaggtgtagtgtgtgctggacacgacaac
aaccagcccgactcctttgcagccttgctctctagcctcaatgaactgggagagagacag
cttgtacacgtggtcaagtgggccaaggccttgcctggtttccgcaacttacacgtggac
gaccagatggctgtcattcagtactcctggatgggactcatggtgtttgccatgggctgg
cgatccttcaccaatgtcaactccaggatgctctacttcgcccctgatctggttttcaat
gagtaccgcatgcacaagtcccggatgtacagccagtgtgtccgaatgaggcacctctct
caagagtttggatggctccaaatcaccccccaggaattcctgtgcatgaaagcactgcta
ctcttcagcattattccagtggatgggctgaaaaatcaaaaattctttgatgaacttcga
atgaactacatcaaggaactcgatcgtatcattgcatgcaaaagaaaaaatcccacatcc
tgctcaagacgcttctaccagctcaccaagctcctggactccgtgcagcctattgcgaga
gagctgcatcagttcacttttgacctgctaatcaagtcacacatggtgagcgtggacttt
ccggaaatgatggcagagatcatctctgtgcaagtgcccaagatcctttctgggaaagtc
aagcccatctatttccacacccagtga

DBGET integrated database retrieval system