KEGG   Pongo abelii (Sumatran orangutan): 100171578
Entry
100171578         CDS       T01416                                 

Gene name
PLAU
Definition
(RefSeq) urokinase-type plasminogen activator precursor
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04610  Complement and coagulation cascades
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100171578 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100171578 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100171578 (PLAU)
   05206 MicroRNAs in cancer
    100171578 (PLAU)
   05205 Proteoglycans in cancer
    100171578 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    100171578 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100171578 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100171578 (PLAU)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     100171578 (PLAU)
Peptidases and inhibitors [BR:pon01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100171578 (PLAU)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100171578 (PLAU)
SSDB
Motif
Pfam: Trypsin Kringle DUF316 Trypsin_2 EGF DUF1986
Other DBs
NCBI-GeneID: 100171578
NCBI-ProteinID: NP_001124729
Ensembl: ENSPPYG00000002324
UniProt: Q5RF29
LinkDB
Position
10
AA seq 431 aa
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLAWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRWRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIV
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFIDYPKKEDYIVYLG
RSRLNSHTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIHSKEGRCAQPSRTIQTICL
PSMYNDPPFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSYFLPWIR
SHTKEENGLAL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagagccctgctggcgcgcctgcttctctgcgtcctggtcgtgagcgactccaaaggc
agcaatgaacttcatcaagttccatcgaactgtgactgtctaaatggaggaacatgtgtg
tccaacaagtacttctccaacattcactggtgcaactgcccaaagaaattcggagggcag
cactgtgaaatagataagtcaaaaacctgctatgaggggaatggtcacttttaccgagga
aaggccagcactgacaccatgggccggccctgcctggcctggaactctgccactgtcctt
cagcaaacataccatgcccacagatctgatgctcttcagctgggcctggggaaacacaat
tactgcaggaacccagacaaccggtggcgaccctggtgctatgtgcaggtgggcctaaag
ccgcttgtccaagagtgcatggtgcatgactgcgcagatggaaaaaagccctcctctcct
ccagaagaattaaaatttcagtgtggccaaaagactctgaggccccgctttaagattgtt
gggggagaattcaccaccatcgagaaccagccctggtttgcggccatctacaggaggcac
cgggggggctctgtcacctatgtgtgtggaggcagcctcatcagcccttgctgggtggtc
agcgccacacactgcttcattgattacccgaagaaggaggactacatcgtctacctgggt
cgctcaaggcttaactcccacacgcaaggggagatgaagtttgaggtggaaaacctcatc
ctacacaaggactacagcgctgacacgctcgctcaccacaacgacattgccttgctgaag
atccattccaaggagggcaggtgtgcgcagccatcccggactatacagaccatctgcctg
ccctcgatgtataacgatcccccgtttggcacaagctgtgagatcactggctttggaaaa
gagaattctactgactatctctatccggagcagctgaaaatgactgttgtgaagctgatt
tcccaccgggagtgtcagcagccccactactacggctctgaggtcaccaccaaaatgctg
tgtgctgccgacccacagtggaaaacagattcctgccagggagactcagggggacccctc
gtctgttccctccaaggccgcatgactttgactggaattgtgagctggggccgtggatgt
gctctgaaggacaagccaggcgtctacacgagagtctcatacttcttgccctggatccgc
agtcacaccaaggaagagaatggcctagccctctga

DBGET integrated database retrieval system